Lus10025065 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 197 / 6e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 151 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 147 / 2e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 144 / 3e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 142 / 3e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 139 / 3e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 132 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT5G49040 125 / 1e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 123 / 5e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21110 117 / 2e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034478 393 / 3e-140 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 261 / 3e-89 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 256 / 3e-86 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 252 / 1e-85 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 247 / 7e-83 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 237 / 2e-78 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 234 / 1e-77 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 226 / 5e-75 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 213 / 4e-70 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 199 / 1e-64 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 161 / 7e-50 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 159 / 1e-48 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 153 / 7e-47 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 154 / 1e-46 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.006G195300 152 / 3e-46 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 152 / 7e-46 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023600 146 / 7e-44 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 143 / 9e-43 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 142 / 3e-42 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10025065 pacid=23167796 polypeptide=Lus10025065 locus=Lus10025065.g ID=Lus10025065.BGIv1.0 annot-version=v1.0
ATGATGGGGTTATGTTTGGCTATTTTAGTAATTTCCTTGGTCGTGACCAAGCCATCGGCCCAATCGGTCAACTGGGCCAAGAGGGTCGACTCTGGCAACG
GTCCAGATGTGATCACGAACATGCAGTTCTACTTCCACGACATAATAAGCGGGAGCAACCCAACCGCTGAGAAGGTGGTCGAACCGGTTTCCGGGTCATC
CACCAATTTCGGCCAAATCAACATAGCCGACGACGCACTGACCGAGACCTCTGACCCCAAGTCCAAGCTCGTAGGCAGGGCTCAGGGGCTCTACGGTTCT
GCAAGCGAGAACGACATGGCTCTGCTAATGGTCATGAGCTATGGATTCACCGATGGACCCTATAAAGGTAGCTCACTCAGCATCATGGGCAAGAACCCAG
CCATGAACCCGACCCGGGAGCTACCCGTTCTGGGTGGCACAGGCCTGTTCAGGATGGCGCGTGGGTACGCCCTCATGAAGACGGTGTCGTTTAATTCGGC
AGGAGACGCTGTTGTGCATTATAATGTGACGGTGCATGCTCCGGCGGACAACGAAGCCGCGCCGGCTTCTACTTCTTCCGTGAGTCGCAGTGGTGGTGCC
ACTGGCTCGCCGAAATCTTCGTCGGCGTCGTCTTCTGCTTCAACCCCGGTGATTTTGCGTGGGACGCAATGGGTCGTTAGTGCTTTGATGGCTTTCATTT
GTTTATCGTCATATAAATAG
AA sequence
>Lus10025065 pacid=23167796 polypeptide=Lus10025065 locus=Lus10025065.g ID=Lus10025065.BGIv1.0 annot-version=v1.0
MMGLCLAILVISLVVTKPSAQSVNWAKRVDSGNGPDVITNMQFYFHDIISGSNPTAEKVVEPVSGSSTNFGQINIADDALTETSDPKSKLVGRAQGLYGS
ASENDMALLMVMSYGFTDGPYKGSSLSIMGKNPAMNPTRELPVLGGTGLFRMARGYALMKTVSFNSAGDAVVHYNVTVHAPADNEAAPASTSSVSRSGGA
TGSPKSSSASSSASTPVILRGTQWVVSALMAFICLSSYK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10025065 0 1
AT3G08680 Leucine-rich repeat protein ki... Lus10025210 1.0 0.9683
AT2G21100 Disease resistance-responsive ... Lus10034479 2.0 0.9657
AT1G32910 HXXXD-type acyl-transferase fa... Lus10034786 3.5 0.9448
AT2G30210 LAC3 laccase 3 (.1) Lus10042249 3.5 0.9496
AT1G32910 HXXXD-type acyl-transferase fa... Lus10033327 3.9 0.9424
AT1G52340 SIS4, SDR1, ISI... SHORT-CHAIN DEHYDROGENASE REDU... Lus10021320 4.7 0.9222
AT2G37360 ABCG2 ATP-binding cassette G2, ABC-2... Lus10025281 4.9 0.9396
AT3G08680 Leucine-rich repeat protein ki... Lus10021383 7.1 0.9237
AT3G18400 NAC ANAC058 NAC domain containing protein ... Lus10009029 7.5 0.9113
AT2G48140 EDA4 embryo sac development arrest ... Lus10006906 7.5 0.9160

Lus10025065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.