Lus10025067 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 213 / 1e-70 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 150 / 3e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 149 / 1e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 147 / 6e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 140 / 3e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 134 / 8e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 129 / 8e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21110 123 / 2e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 123 / 2e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT4G38700 123 / 2e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034476 333 / 6e-118 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 217 / 2e-72 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 215 / 1e-71 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 217 / 2e-71 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 213 / 3e-70 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 205 / 1e-66 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 203 / 3e-66 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 203 / 7e-66 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 200 / 8e-65 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 211 / 3e-70 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 173 / 6e-55 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 166 / 4e-52 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 163 / 3e-51 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 160 / 4e-50 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 156 / 2e-48 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 154 / 1e-47 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 152 / 1e-46 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 149 / 1e-45 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G023600 147 / 6e-45 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10025067 pacid=23167746 polypeptide=Lus10025067 locus=Lus10025067.g ID=Lus10025067.BGIv1.0 annot-version=v1.0
ATGTCGCTACTCTTCGTCGTAACGCTCCTCCTCCTCTTCGTGGCGGTTTCCGGCCACAACAAACAATTTCCATCAACGTCGTCTTCGGTCAAGTGGGCGA
CGAGGAAGGAGTCTTGCGATCCGGGCAAGGAGACGGTAACCAACCTCCAATTCTACTTCCATGACGTCGTCAAGGGGAATAACCCGACCGCAGTGAGGGT
GGCTCAGGCGGCTGGAACGGACAAGTCGCCGACGCTATTCGGGGAGATTTTGATGGCGGATGACCCGCTTACGGAGACAGCTGACCCGACGTCCAAGCTG
ATTGGGCGGGCCCAGGGGCTTTATGGGTCTGCGTCGCAGAATGATGTAGGCTTGATTATGGCGCTGGGCTTCAGCTTTGTCGATGGGCCTTATAATGGGA
GTACGATAAGCGTGGTGGGGAAAAATCCGGCGACGAATCCGAACAGGGAGCTGCCGGTGGTCGGCGGCACGGGGGTTTTCAGGATGGCACGTGGGTACGC
ACTGCTTAAAACGGATCCGCTTACTCAGGTCGGGAATGCGGTGGTTCACTACGATGTTACCGTGCACACGCCCCCAGCTGACTGTCACTGA
AA sequence
>Lus10025067 pacid=23167746 polypeptide=Lus10025067 locus=Lus10025067.g ID=Lus10025067.BGIv1.0 annot-version=v1.0
MSLLFVVTLLLLFVAVSGHNKQFPSTSSSVKWATRKESCDPGKETVTNLQFYFHDVVKGNNPTAVRVAQAAGTDKSPTLFGEILMADDPLTETADPTSKL
IGRAQGLYGSASQNDVGLIMALGFSFVDGPYNGSTISVVGKNPATNPNRELPVVGGTGVFRMARGYALLKTDPLTQVGNAVVHYDVTVHTPPADCH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10025067 0 1
AT2G01570 GRAS RGA1 REPRESSOR OF GA1-3 1, REPRESSO... Lus10018098 17.9 0.6106
AT1G80930 MIF4G domain-containing protei... Lus10011226 19.4 0.6105
AT3G26040 HXXXD-type acyl-transferase fa... Lus10021387 28.8 0.5730
AT5G59100 Subtilisin-like serine endopep... Lus10040751 46.5 0.5737
AT1G05675 UDP-Glycosyltransferase superf... Lus10010467 47.2 0.5111
AT2G41970 Protein kinase superfamily pro... Lus10021070 65.2 0.5500
AT4G05220 Late embryogenesis abundant (L... Lus10007636 68.2 0.5303
AT4G12490 Bifunctional inhibitor/lipid-t... Lus10024619 70.0 0.5219
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Lus10029877 82.6 0.5207
AT5G04390 C2H2ZnF C2H2-type zinc finger family p... Lus10040425 84.1 0.5252

Lus10025067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.