Lus10025084 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38490 53 / 3e-09 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023998 147 / 2e-41 AT3G09880 359 / 3e-117 Protein phosphatase 2A regulatory B subunit family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G177800 76 / 9e-18 AT4G38490 69 / 2e-15 unknown protein
PFAM info
Representative CDS sequence
>Lus10025084 pacid=23167735 polypeptide=Lus10025084 locus=Lus10025084.g ID=Lus10025084.BGIv1.0 annot-version=v1.0
ATGTTGACAAGCTGCATGAATTGGCACATGTCGCCTTCTATTACTAGGGTTCCTAACAACTGCTGTTCAGGTTTGCTTGCTCCATGTATTGCTAGACTTC
CATATGGAACTATCAAATTCGATCAAAGGATGAGTAAAAAGAATTCCTGTTGGTTTCAAAGAAGGCTTCCAGGAGGTACAATGTGGAAGTCTTCAGTGAG
GAATTCTCATGTCTCGTCTGCCGGAAGTGATGGTTACCGGCTGAACCATGCAGACAATTTTCCTAAGGTGGAACCGCTCTCGATAATCCTTATGAAGAAG
TTGAGATCTGTATTAGTTTTCCTGGTAGAGCAACCAAGTCAGCTTAAGCACTTGGAGTGGCCAGGTTTCCAGAGCACGCTGACGACTGCTACGCTAACCC
TTGTTCTTGTTGCGCTGCTCATCGTGGCGCTGTCATCCGTTGACTCCATATTATGCTATCTACTGGCTTTGTTCCTTAGGAGAACTGCATGA
AA sequence
>Lus10025084 pacid=23167735 polypeptide=Lus10025084 locus=Lus10025084.g ID=Lus10025084.BGIv1.0 annot-version=v1.0
MLTSCMNWHMSPSITRVPNNCCSGLLAPCIARLPYGTIKFDQRMSKKNSCWFQRRLPGGTMWKSSVRNSHVSSAGSDGYRLNHADNFPKVEPLSIILMKK
LRSVLVFLVEQPSQLKHLEWPGFQSTLTTATLTLVLVALLIVALSSVDSILCYLLALFLRRTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G38490 unknown protein Lus10025084 0 1
AT3G12480 CCAAT NF-YC11 "nuclear factor Y, subunit C11... Lus10041638 17.9 0.7810
AT5G51545 LPA2 low psii accumulation2 (.1) Lus10031131 23.8 0.7965
AT5G45170 Haloacid dehalogenase-like hyd... Lus10040631 25.1 0.7898
AT5G04810 pentatricopeptide (PPR) repeat... Lus10028850 25.3 0.7852
AT1G20830 MCD1 multiple chloroplast division ... Lus10013209 27.8 0.7663
AT1G53120 RNA-binding S4 domain-containi... Lus10005545 29.7 0.7419
AT5G40160 EMB139, EMB506 embryo defective 506, EMBRYO D... Lus10014522 30.4 0.7861
AT1G53800 unknown protein Lus10003930 33.7 0.7934
AT1G20810 FKBP-like peptidyl-prolyl cis-... Lus10025158 62.9 0.7590
AT2G48120 PAC pale cress protein (PAC) (.1),... Lus10000662 76.7 0.7490

Lus10025084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.