Lus10025086 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023996 227 / 1e-77 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G138700 76 / 4e-18 ND /
Potri.004G178500 68 / 3e-15 ND /
PFAM info
Representative CDS sequence
>Lus10025086 pacid=23167778 polypeptide=Lus10025086 locus=Lus10025086.g ID=Lus10025086.BGIv1.0 annot-version=v1.0
ATGGAGCTAAGAGTCAACCATCTTGCAGCAGGGGAAAGGAAGGTGTCATCCCCGAAACGAGAGAGGTCGATGAAAGGAAGAAGGCTGACGAGGAGTAACC
AGCTACAGCACCACCAGCAGCTGCTCGAATCGATTGCGAGAGCCAACAGTGGAGGAGGCGTTGTTAGTCATGAAGGAGGAGGCGGTGGAGTTGTTAGGAT
GAAGGTGCTGGTGAAGAAGCAAGATTTAAAGCTGATGCTGGAGCTATTGGGAGATGGCAAGTTGCAGAGCAGTAGCTTCAGGCCTATTGGCGCTGAAACC
GAATTGCCTTCATCGTCGTTCTCTAATGTGGAACAAAGATTGAATCTTTTGAGGAGGAAGCATGTGTCGAGAGGAAATGGTGGAAAGGGTTGCCGGGATT
CGTCCCCGCGGTCGTGGATTCCAGCGCTTCAAAGCATTCCGGAGTAG
AA sequence
>Lus10025086 pacid=23167778 polypeptide=Lus10025086 locus=Lus10025086.g ID=Lus10025086.BGIv1.0 annot-version=v1.0
MELRVNHLAAGERKVSSPKRERSMKGRRLTRSNQLQHHQQLLESIARANSGGGVVSHEGGGGGVVRMKVLVKKQDLKLMLELLGDGKLQSSSFRPIGAET
ELPSSSFSNVEQRLNLLRRKHVSRGNGGKGCRDSSPRSWIPALQSIPE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025086 0 1
Lus10023996 9.5 0.8670
AT2G24400 SAUR-like auxin-responsive pro... Lus10026977 20.0 0.7678
AT3G58310 Domain of unknown function (DU... Lus10042124 22.1 0.7297
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10036147 38.4 0.7974
AT5G40830 ATRAD3, ATATR S-adenosyl-L-methionine-depend... Lus10007588 38.5 0.7593
AT5G15490 UGD3 UDP-glucose dehydrogenase 3, U... Lus10021626 48.6 0.7976
AT3G02230 ATRGP1, RGP1 ARABIDOPSIS THALIANA REVERSIBL... Lus10022443 59.6 0.7964
AT2G17080 Arabidopsis protein of unknown... Lus10023954 60.7 0.7560
AT1G50720 Stigma-specific Stig1 family p... Lus10011117 63.8 0.7967
AT5G65230 MYB ATMYB53 myb domain protein 53 (.1) Lus10039734 73.9 0.7317

Lus10025086 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.