Lus10025111 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47450 54 / 8e-10 CPSRP43, CAO CHLOROPLAST SIGNAL RECOGNITION PARTICLE 43, CHAOS, chloroplast signal recognition particle component (CAO) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023973 120 / 4e-34 AT2G47450 391 / 2e-135 CHLOROPLAST SIGNAL RECOGNITION PARTICLE 43, CHAOS, chloroplast signal recognition particle component (CAO) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G140500 66 / 5e-14 AT2G47450 423 / 7e-148 CHLOROPLAST SIGNAL RECOGNITION PARTICLE 43, CHAOS, chloroplast signal recognition particle component (CAO) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0049 Tudor PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Representative CDS sequence
>Lus10025111 pacid=23167804 polypeptide=Lus10025111 locus=Lus10025111.g ID=Lus10025111.BGIv1.0 annot-version=v1.0
ATGGCGGAGGCTGTAGTGGGGAAGAGAGAGGTCGAAGGGGATGACGTGGAGGGGAAGAAGATGAAGAAGAAGGAGTACTTGGTGAAATGGACGGATGTAG
ATGATGCCACATGGGAGCCTGAGGAGAATGTGGACCCGGATTTGGTGATGGAGTTCGAGGCGGGAAATGTTGAGCCCATTATTAGTAGTGAGGGAATATT
CAAGAGTGCTGAGGTTGAGATTGGTTGGGGAGATGGACGTGGGGCTGGACGAGTAGTGGGGATCGACGGATCTGGTGGTAGTGGTCAAAGAAGAGGAGGT
GATGGTCGGAGTCGGAGATAG
AA sequence
>Lus10025111 pacid=23167804 polypeptide=Lus10025111 locus=Lus10025111.g ID=Lus10025111.BGIv1.0 annot-version=v1.0
MAEAVVGKREVEGDDVEGKKMKKKEYLVKWTDVDDATWEPEENVDPDLVMEFEAGNVEPIISSEGIFKSAEVEIGWGDGRGAGRVVGIDGSGGSGQRRGG
DGRSRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G47450 CPSRP43, CAO CHLOROPLAST SIGNAL RECOGNITION... Lus10025111 0 1
AT4G26670 Mitochondrial import inner mem... Lus10032577 2.4 0.7925
AT5G54855 Pollen Ole e 1 allergen and ex... Lus10003874 3.0 0.7308
AT4G21970 Protein of unknown function, D... Lus10006781 9.5 0.7180
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Lus10021410 11.0 0.7797
AT5G24690 Protein of unknown function (D... Lus10022966 13.2 0.6760
AT3G59980 Nucleic acid-binding, OB-fold-... Lus10025611 15.6 0.7031
AT5G55670 RNA-binding (RRM/RBD/RNP motif... Lus10038757 19.9 0.6535
AT3G11670 DGD1 DIGALACTOSYL DIACYLGLYCEROL DE... Lus10029404 24.2 0.6968
AT3G57930 unknown protein Lus10031233 25.9 0.6694
AT4G10810 unknown protein Lus10022380 27.7 0.6616

Lus10025111 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.