Lus10025112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011217 208 / 1e-63 AT1G61100 475 / 5e-156 disease resistance protein (TIR class), putative (.1), disease resistance protein (TIR class), putative (.2)
Lus10018471 189 / 1e-56 AT1G61100 474 / 1e-155 disease resistance protein (TIR class), putative (.1), disease resistance protein (TIR class), putative (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G038300 67 / 2e-13 AT1G61100 462 / 1e-149 disease resistance protein (TIR class), putative (.1), disease resistance protein (TIR class), putative (.2)
Potri.011G046900 67 / 2e-13 AT1G61100 484 / 6e-158 disease resistance protein (TIR class), putative (.1), disease resistance protein (TIR class), putative (.2)
PFAM info
Representative CDS sequence
>Lus10025112 pacid=23167888 polypeptide=Lus10025112 locus=Lus10025112.g ID=Lus10025112.BGIv1.0 annot-version=v1.0
ATGAACTCGGAGAACCAACGTTTGGCAATTAAGAGAACGGATCATACAGACGAAGATCTCGTCATTTCGCGAGCATTCGATGGATCGAGAAGTGGATTAG
CTGATGTTCTATCTTCAAGTGAAAGCCTTTCATCATCCAGAGTGAAACCTGGAAAAGGAGGGGAAGATTGGTTTGTGGCCAATAATCATTCAGTGGCTAA
CAATGAAGAAGCAATGTTCTCTGCAGATTACATTGTTGGAGTGGAAACCAATTCTGCAGCAAAAGCAGAGATGATTCCTCGAGGCAGATTGGTCGACGAT
TCGTTCATGTTAAACAATGCTCGACCAGCTGCTGATCAGTACGACTCTTCTTGGAGAACAGACATAGCAATGGCTGCAGATATTTCGATGTCCTCTTCGT
CTCCACTCGAAAATGGGAATGCCAAAGAGAAGAGTACTCACAGTTATGGAATCCTGGTCTACTACTGA
AA sequence
>Lus10025112 pacid=23167888 polypeptide=Lus10025112 locus=Lus10025112.g ID=Lus10025112.BGIv1.0 annot-version=v1.0
MNSENQRLAIKRTDHTDEDLVISRAFDGSRSGLADVLSSSESLSSSRVKPGKGGEDWFVANNHSVANNEEAMFSADYIVGVETNSAAKAEMIPRGRLVDD
SFMLNNARPAADQYDSSWRTDIAMAADISMSSSSPLENGNAKEKSTHSYGILVYY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G61100 disease resistance protein (TI... Lus10025112 0 1
AT1G53200 unknown protein Lus10005971 2.6 0.8908
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10029816 5.3 0.8860
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10020736 6.7 0.8794
AT3G48010 ATCNGC16 cyclic nucleotide-gated channe... Lus10042132 7.7 0.8566
AT4G24190 AtHsp90-7, HSP9... SHEPHERD, HEAT SHOCK PROTEIN 9... Lus10035109 8.5 0.8654
AT5G06540 Pentatricopeptide repeat (PPR)... Lus10031424 9.5 0.8645
AT3G24530 AAA-type ATPase family protein... Lus10005293 9.8 0.8792
AT4G13750 EMB2597, NOV NO VEIN, EMBRYO DEFECTIVE 2597... Lus10022572 9.9 0.8696
AT2G36960 MYB TKI1 TSL-kinase interacting protein... Lus10010230 10.0 0.8632
AT4G04350 EMB2369 EMBRYO DEFECTIVE 2369, tRNA sy... Lus10020041 10.7 0.8709

Lus10025112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.