Lus10025114 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29420 99 / 4e-27 SAUR-like auxin-responsive protein family (.1)
AT1G29450 99 / 6e-27 SAUR-like auxin-responsive protein family (.1)
AT1G29500 97 / 3e-26 SAUR-like auxin-responsive protein family (.1)
AT5G27780 94 / 3e-25 SAUR-like auxin-responsive protein family (.1)
AT1G29460 93 / 9e-25 SAUR-like auxin-responsive protein family (.1)
AT1G29490 88 / 3e-23 SAUR-like auxin-responsive protein family (.1)
AT1G29430 84 / 2e-21 SAUR-like auxin-responsive protein family (.1)
AT1G29510 84 / 4e-21 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
AT1G29440 81 / 3e-20 SAUR-like auxin-responsive protein family (.1)
AT1G76190 78 / 5e-19 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023970 255 / 2e-88 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1)
Lus10023969 85 / 4e-21 AT5G27780 96 / 1e-25 SAUR-like auxin-responsive protein family (.1)
Lus10025115 74 / 6e-17 AT1G29430 88 / 6e-23 SAUR-like auxin-responsive protein family (.1)
Lus10034570 70 / 4e-16 AT1G76190 122 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10021825 69 / 1e-15 AT1G76190 110 / 1e-32 SAUR-like auxin-responsive protein family (.1)
Lus10003337 72 / 3e-15 AT5G22800 855 / 0.0 EMBRYO DEFECTIVE 86, EMBRYO DEFECTIVE 263, EMBRYO DEFECTIVE 1030, Alanyl-tRNA synthetase, class IIc (.1)
Lus10007060 67 / 2e-14 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1)
Lus10034507 64 / 2e-13 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012426 64 / 3e-13 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G140900 115 / 3e-33 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.004G181400 112 / 2e-32 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G141201 110 / 9e-32 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G141150 104 / 3e-29 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Potri.017G043400 103 / 6e-29 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1)
Potri.009G141000 100 / 2e-27 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Potri.017G043500 95 / 1e-25 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1)
Potri.009G141251 89 / 4e-23 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Potri.009G141100 88 / 9e-23 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.004G181500 85 / 1e-21 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10025114 pacid=23167780 polypeptide=Lus10025114 locus=Lus10025114.g ID=Lus10025114.BGIv1.0 annot-version=v1.0
ATGATAAACCCAAAGAAGCTAATCAAGATGGCCAAGAAGTGGCAGAGGAAGAGCATGAGCTTCAACTCCAGGACCAGCTACTCCTCCGTCGATTTCGACA
TCACCAAGTTCAATTCCTCCCCTGTCGCCAACAGGGGACACTTCGTCGTCTACACCGCCGACTTCAAGCGCTTCGTCCTCCCTCTCTCCTACCTCGAGCA
CGCCGTCTTCCGGGAGCTCTTCCAGAAGTCTGAGGAAGAGTTCGGAGCTCCGGGCGACGGCCCCATCATGGTCCCATGCGACTCTGTTTTCATGGAGAAT
GCCGTCTGGCGGATCCAGAAGTTATCATCATCGGAGGCGGAGGTTAAGGGTGGTAAGGGGAGTTTTTCGGCGACGACCGCGTCGTTCTCGCCGGTGGCTT
CGTCGGTTCGCGGCGCCGGTGCTCGTGCTTTCCGGTCGAGGAGTAGCTTGCTTGGTTGA
AA sequence
>Lus10025114 pacid=23167780 polypeptide=Lus10025114 locus=Lus10025114.g ID=Lus10025114.BGIv1.0 annot-version=v1.0
MINPKKLIKMAKKWQRKSMSFNSRTSYSSVDFDITKFNSSPVANRGHFVVYTADFKRFVLPLSYLEHAVFRELFQKSEEEFGAPGDGPIMVPCDSVFMEN
AVWRIQKLSSSEAEVKGGKGSFSATTASFSPVASSVRGAGARAFRSRSSLLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G29450 SAUR-like auxin-responsive pro... Lus10025114 0 1
AT5G45650 subtilase family protein (.1) Lus10026062 8.9 0.8274
Lus10021782 12.7 0.8248
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 15.6 0.8248
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 18.0 0.8248
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 20.1 0.8248
AT3G19540 Protein of unknown function (D... Lus10028040 22.0 0.8248
Lus10023587 23.8 0.8248
Lus10007927 25.5 0.8248
AT4G12570 UPL5 ubiquitin protein ligase 5 (.1... Lus10039026 27.0 0.8248
AT2G34320 Polynucleotidyl transferase, r... Lus10039942 28.5 0.8248

Lus10025114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.