Lus10025115 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29430 90 / 2e-23 SAUR-like auxin-responsive protein family (.1)
AT5G27780 87 / 3e-22 SAUR-like auxin-responsive protein family (.1)
AT1G29450 84 / 5e-21 SAUR-like auxin-responsive protein family (.1)
AT1G29420 83 / 7e-21 SAUR-like auxin-responsive protein family (.1)
AT1G29460 81 / 4e-20 SAUR-like auxin-responsive protein family (.1)
AT1G29440 81 / 4e-20 SAUR-like auxin-responsive protein family (.1)
AT1G29510 81 / 5e-20 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
AT1G29500 80 / 1e-19 SAUR-like auxin-responsive protein family (.1)
AT1G76190 74 / 2e-17 SAUR-like auxin-responsive protein family (.1)
AT1G20470 67 / 1e-14 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023969 277 / 6e-97 AT5G27780 96 / 1e-25 SAUR-like auxin-responsive protein family (.1)
Lus10025114 73 / 7e-17 AT1G29450 99 / 4e-27 SAUR-like auxin-responsive protein family (.1)
Lus10023970 73 / 9e-17 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1)
Lus10003337 68 / 1e-13 AT5G22800 855 / 0.0 EMBRYO DEFECTIVE 86, EMBRYO DEFECTIVE 263, EMBRYO DEFECTIVE 1030, Alanyl-tRNA synthetase, class IIc (.1)
Lus10021825 64 / 1e-13 AT1G76190 110 / 1e-32 SAUR-like auxin-responsive protein family (.1)
Lus10034570 62 / 4e-13 AT1G76190 122 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10007060 60 / 5e-12 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1)
Lus10012181 59 / 7e-12 AT4G34770 97 / 3e-27 SAUR-like auxin-responsive protein family (.1)
Lus10012426 60 / 8e-12 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G043400 103 / 9e-29 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1)
Potri.004G181400 103 / 1e-28 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G141201 100 / 3e-27 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G140900 99 / 6e-27 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.017G043500 97 / 2e-26 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1)
Potri.009G141150 93 / 1e-24 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G141000 87 / 2e-22 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Potri.009G141251 86 / 3e-22 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Potri.002G064300 84 / 2e-21 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.009G141100 77 / 9e-19 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10025115 pacid=23167756 polypeptide=Lus10025115 locus=Lus10025115.g ID=Lus10025115.BGIv1.0 annot-version=v1.0
ATGGCAAAGAAGTGGCAGAGGATTGCAGCAGCAAGCAAGACAGGAGGAAGGATCAGGATCACACTCCCCAAGCTCAAACTCATCCACATCATTGCCAATG
GCGATAGTAGCGATGATGAATTCGAAGTGAAGAAAGGGCATTTCGCAGTGTACACAGCCGTCGAGGAAAGGAAGAGGTTTGTGGTTCCACTGGAGTTCCT
CAACGTCACAATCTTCATGCACCTCCTCAAACTGTCCGAAGAACAGCTGGGATTGCCTAGCGACGGACCGATCACTCTGCCTTGCGACCCAAGCTTCCTC
GAGTACCTAATCGGGTTGGTTCAGAACCAGAGGTACTCCATTCCTGAAGACCTGGAGAAGACTCTGCTCAGTGTCTCCACGGGGATGACTGCTGCTCTGC
ATTCTTCTTCTTCTGGTGGCGGGTTGGAGATGGTTGAGATGATGAACCACCATCCAAATGTCATCTACGGGTTCTAA
AA sequence
>Lus10025115 pacid=23167756 polypeptide=Lus10025115 locus=Lus10025115.g ID=Lus10025115.BGIv1.0 annot-version=v1.0
MAKKWQRIAAASKTGGRIRITLPKLKLIHIIANGDSSDDEFEVKKGHFAVYTAVEERKRFVVPLEFLNVTIFMHLLKLSEEQLGLPSDGPITLPCDPSFL
EYLIGLVQNQRYSIPEDLEKTLLSVSTGMTAALHSSSSGGGLEMVEMMNHHPNVIYGF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G29430 SAUR-like auxin-responsive pro... Lus10025115 0 1
AT5G27780 SAUR-like auxin-responsive pro... Lus10023969 1.4 0.9640
AT4G38840 SAUR-like auxin-responsive pro... Lus10008991 3.2 0.9636
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Lus10008673 4.2 0.9565
AT1G26945 bHLH KDR, PRE6 KIDARI, basic helix-loop-helix... Lus10037198 5.3 0.9440
AT4G38840 SAUR-like auxin-responsive pro... Lus10009001 8.5 0.9409
AT4G38840 SAUR-like auxin-responsive pro... Lus10009628 18.6 0.9348
AT5G64330 JK218, RPT3, NP... ROOT PHOTOTROPISM 3, NON-PHOTO... Lus10040484 18.7 0.9349
AT4G34770 SAUR-like auxin-responsive pro... Lus10016917 22.1 0.9149
AT1G21460 SWEET1, AtSWEET... Nodulin MtN3 family protein (.... Lus10028634 23.0 0.9264
AT1G30700 FAD-binding Berberine family p... Lus10035466 23.4 0.8588

Lus10025115 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.