Lus10025146 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01880 108 / 2e-30 RING/U-box superfamily protein (.1)
AT3G10910 108 / 6e-30 RING/U-box superfamily protein (.1)
AT1G49210 104 / 3e-28 RING/U-box superfamily protein (.1)
AT5G05280 102 / 5e-28 RING/U-box superfamily protein (.1)
AT1G49220 103 / 2e-27 RING/U-box superfamily protein (.1)
AT1G49200 101 / 8e-27 RING/U-box superfamily protein (.1)
AT1G49230 100 / 2e-26 RING/U-box superfamily protein (.1)
AT3G18773 99 / 3e-26 RING/U-box superfamily protein (.1)
AT1G76410 95 / 9e-25 ATL8 RING/U-box superfamily protein (.1)
AT2G17450 89 / 3e-22 RHA3A RING-H2 finger A3A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022743 134 / 3e-40 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10029037 117 / 8e-34 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10005814 110 / 3e-30 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Lus10005817 107 / 9e-29 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1)
Lus10006788 105 / 3e-28 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1)
Lus10025145 102 / 5e-28 AT5G01880 96 / 6e-26 RING/U-box superfamily protein (.1)
Lus10025228 101 / 1e-27 AT5G01880 97 / 5e-26 RING/U-box superfamily protein (.1)
Lus10036380 100 / 2e-27 AT5G05280 96 / 2e-25 RING/U-box superfamily protein (.1)
Lus10025144 100 / 3e-27 AT5G01880 87 / 5e-22 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G136200 130 / 1e-38 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.013G091300 128 / 1e-37 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.019G057700 119 / 3e-34 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.019G010500 114 / 9e-32 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Potri.019G130100 110 / 6e-31 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Potri.001G309600 109 / 4e-30 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.013G157000 106 / 1e-29 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1)
Potri.001G159300 99 / 2e-26 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Potri.001G309700 99 / 7e-26 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.005G099000 97 / 2e-25 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10025146 pacid=23167783 polypeptide=Lus10025146 locus=Lus10025146.g ID=Lus10025146.BGIv1.0 annot-version=v1.0
ATGACACGAATCCTCACTCTCCACCGCCGCCTCCTCCGTTCAGCTTGGAATGAGATAGAGGATTCGGAAACTAGCAAGGCCGATTTTGAGGGAAACTTAG
AGATAGTGCTGGCTGCTCTGCTCTGCGCTCTCATGGTCGCTATCGGCTTGAATTGGATCGCCCACTGCGCGTTGCGCCGCAGCAACAGCCGCCCTGCGGC
GGCGGCGGCGGTGAGGAATAATGGGTTGAAGAAGAGTCATCTGAGGCAGATCCCTGTGGCAGTTTACGGGTCGGATGCGGGTGCCCATCATGTGACGGAG
TGCTCGATCTGTTTAGGGGAGTTCTTGGACGGGGAGAGAGTTCGGGTCCTGCCCAAATGCAGCCATGGGTTCCACGTGTGGTGCATCGACAAATGGCTGA
CGTTACATTCATCTTGCCCCAACTGTCGGCACACGGTGACTGGTTCGAATCCGAAGGTTGTGGGAAATGGTGGGCAAGAAGGTAATGATGTTGATGTGGT
TGTTCAAGGTGTTACTTGA
AA sequence
>Lus10025146 pacid=23167783 polypeptide=Lus10025146 locus=Lus10025146.g ID=Lus10025146.BGIv1.0 annot-version=v1.0
MTRILTLHRRLLRSAWNEIEDSETSKADFEGNLEIVLAALLCALMVAIGLNWIAHCALRRSNSRPAAAAAVRNNGLKKSHLRQIPVAVYGSDAGAHHVTE
CSICLGEFLDGERVRVLPKCSHGFHVWCIDKWLTLHSSCPNCRHTVTGSNPKVVGNGGQEGNDVDVVVQGVT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10910 RING/U-box superfamily protein... Lus10025146 0 1
AT3G24020 Disease resistance-responsive ... Lus10011767 3.5 0.9291
AT3G24020 Disease resistance-responsive ... Lus10023689 5.1 0.9278
AT4G33925 SSN2 suppressor of sni1 2, unknown ... Lus10019878 8.5 0.8912
AT3G11550 CASP2 Casparian strip membrane domai... Lus10029409 9.8 0.9036
AT2G36100 CASP1 Casparian strip membrane domai... Lus10021332 10.6 0.8931
AT3G11550 CASP2 Casparian strip membrane domai... Lus10021333 15.2 0.9131
AT5G12380 ANNAT8 annexin 8 (.1) Lus10019780 16.2 0.8940
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10038260 16.7 0.9001
AT2G27370 CASP3 Casparian strip membrane domai... Lus10017008 16.7 0.8878
AT4G01470 ATTIP1.3, GAMMA... tonoplast intrinsic protein 1;... Lus10040863 22.6 0.8778

Lus10025146 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.