Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01870 104 / 7e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 103 / 1e-29 LTP6 lipid transfer protein 6 (.1.2) AT5G59310 92 / 9e-25 LTP4 lipid transfer protein 4 (.1) AT3G51590 91 / 3e-24 LTP12 lipid transfer protein 12 (.1) AT5G59320 89 / 7e-24 LTP3 lipid transfer protein 3 (.1) AT2G38540 82 / 7e-21 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT2G38530 73 / 3e-17 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G18370 71 / 2e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51600 70 / 4e-16 LTP5 lipid transfer protein 5 (.1) AT4G33355 64 / 7e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025230 [exp] 219 / 2e-74 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10022744 [exp] 119 / 1e-35 AT2G38540 86 / 1e-22 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Lus10000082 [exp] 118 / 4e-35 AT2G38540 88 / 2e-23 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Lus10022745 [exp] 90 / 5e-24 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 89 / 2e-23 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10025151 [exp] 88 / 3e-23 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10015279 [exp] 86 / 2e-22 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10025231 [exp] 86 / 3e-22 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10029226 [exp] 81 / 2e-20 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G136000 [exp] 117 / 8e-35 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 115 / 4e-34 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086500 [exp] 107 / 1e-30 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 106 / 2e-30 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232700 [exp] 91 / 2e-24 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 89 / 1e-23 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.001G232900 [exp] 88 / 4e-23 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G025200 [exp] 82 / 7e-21 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 77 / 7e-19 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 75 / 3e-18 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10025148 pacid=23167874 polypeptide=Lus10025148 locus=Lus10025148.g ID=Lus10025148.BGIv1.0 annot-version=v1.0 ATGGCGACCTCTACTTCTTCTTCCACGATCATTGCTGTGATGCTGGCCGTCACTGTGTTGATGGCAAAAGGAACCACTGCAGCTGTAAGCTGTGGTCAGG TGGTGAACACTCTGTATCCATGCCTAACCTACGTTCAATACGGTGGGGGCATACCTGCTACTTGCTGCAACGGCATCAGGGCACTTAACAATGCTGCTGT AACCACCCCAGACCGCCAAGGAGTATGCAGCTGCCTCGTCTCGTCTCTCCGTGGATTCAACATCAGCCCTTACAGCCTTCGCCTTGCTGCTTCGCTCCCA GCTGGCTGCGGTGTCAACCTTCCCTACAGGATTGATCCTTCCATTGATTGCTCCAGGCTGAGTGAAGATCTGATGTATGCTGATGACAACAGCACTGTTA ATGGCTCCATCAAGAGAGGCCAAGAATAA
AA sequence Show only first row Show all	>Lus10025148 pacid=23167874 polypeptide=Lus10025148 locus=Lus10025148.g ID=Lus10025148.BGIv1.0 annot-version=v1.0 MATSTSSSTIIAVMLAVTVLMAKGTTAAVSCGQVVNTLYPCLTYVQYGGGIPATCCNGIRALNNAAVTTPDRQGVCSCLVSSLRGFNISPYSLRLAASLP AGCGVNLPYRIDPSIDCSRLSEDLMYADDNSTVNGSIKRGQE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01870			Bifunctional inhibitor/lipid-t...		Lus10025148 [exp]	0	1
AT1G17140		RIP1, ICR1	ROP INTERACTIVE PARTNER 1, int...		Lus10013708 [exp]	1.7	0.9428
AT3G61250	MYB	LMI2, ATMYB17	LATE MERISTEM IDENTITY2, myb d...		Lus10014784 [exp]	2.0	0.9254
AT5G45650			subtilase family protein (.1)		Lus10007083 [exp]	4.6	0.9197
AT2G22560			Kinase interacting (KIP1-like)...		Lus10025717 [exp]	4.7	0.8988
AT4G28950		ATRAC7, ARAC7, ...	Arabidopsis RAC-like 7, RHO-re...		Lus10034932 [exp]	5.3	0.9040
AT4G30610		SCPL24, BRS1	SERINE CARBOXYPEPTIDASE 24 PRE...		Lus10015489 [exp]	5.7	0.8897
AT4G30610		SCPL24, BRS1	SERINE CARBOXYPEPTIDASE 24 PRE...		Lus10019954 [exp]	6.0	0.8956
AT5G02130		NDP1	Tetratricopeptide repeat (TPR)...		Lus10024371 [exp]	7.1	0.9083
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10029544 [exp]	7.5	0.8828
AT4G15620			Uncharacterised protein family...		Lus10012562 [exp]	10.5	0.8798

Compare expression of checked genes

Lus10025148 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.