Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13580 71 / 2e-15 ABCG6 ATP-binding cassette G6, ABC-2 type transporter family protein (.1) AT2G39350 68 / 2e-14 ABCG1 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) AT3G53510 66 / 2e-13 ABCG20 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) AT2G37360 63 / 2e-12 ABCG2 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) AT3G55110 62 / 2e-12 ABCG18 ATP-binding cassette G18, ABC-2 type transporter family protein (.1) AT3G55100 59 / 4e-11 ABCG17 ATP-binding cassette G17, ABC-2 type transporter family protein (.1) AT1G31770 50 / 4e-08 ABCG14 ATP-binding cassette G14, ATP-binding cassette 14 (.1) AT1G51460 50 / 5e-08 ABCG13 ATP-binding cassette G13, ABC-2 type transporter family protein (.1) AT1G51500 48 / 2e-07 AtABCG12, WBC12, ABCG12, D3, CER5, ATWBC12 ECERIFERUM 5, ARABIDOPSIS THALIANA WHITE-BROWN COMPLEX 12, ATP-binding cassette G12, ABC-2 type transporter family protein (.1) AT3G52310 48 / 3e-07 ABCG27 ATP-binding cassette G27, ABC-2 type transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030307 [exp] 75 / 6e-17 AT2G37360 366 / 9e-122 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10039859 [exp] 57 / 2e-10 AT2G37360 319 / 5e-97 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10018624 [exp] 57 / 2e-10 AT2G37360 316 / 7e-96 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10028704 [exp] 51 / 3e-08 AT1G71960 818 / 0.0 Arabidopsis thaliana ATP-binding cassette G25, ATP-binding casette G25, ATP-binding casette family G25 (.1) Lus10004274 [exp] 50 / 4e-08 AT2G37360 296 / 2e-90 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10019238 [exp] 50 / 4e-08 AT2G37360 296 / 1e-90 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10034775 [exp] 50 / 5e-08 AT1G31770 1028 / 0.0 ATP-binding cassette G14, ATP-binding cassette 14 (.1) Lus10033315 [exp] 50 / 5e-08 AT1G31770 551 / 0.0 ATP-binding cassette G14, ATP-binding cassette 14 (.1) Lus10023154 [exp] 50 / 6e-08 AT1G17840 613 / 0.0 DESPERADO, CUTICULAR DEFECT AND ORGAN FUSION 1, ARABIDOPSIS THALIANA WHITE-BROWN COMPLEX HOMOLOG PROTEIN 11, ATP-binding cassette G11, white-brown complex homolog protein 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G213400 [exp] 78 / 6e-18 AT3G55090 1014 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.008G047900 [exp] 74 / 1e-16 AT3G55090 1008 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.002G156900 [exp] 65 / 2e-13 AT3G53510 950 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) Potri.014G080200 [exp] 65 / 2e-13 AT2G37360 955 / 0.0 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Potri.006G215100 [exp] 59 / 3e-11 AT3G53510 860 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) Potri.012G045100 [exp] 56 / 3e-10 AT3G55130 270 / 3e-79 ATP-binding cassette G19, white-brown complex homolog 19 (.1) Potri.015G036100 [exp] 55 / 7e-10 AT2G37360 276 / 2e-81 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Potri.013G111900 [exp] 54 / 2e-09 AT1G71960 795 / 0.0 Arabidopsis thaliana ATP-binding cassette G25, ATP-binding casette G25, ATP-binding casette family G25 (.1) Potri.019G083000 [exp] 53 / 4e-09 AT1G71960 782 / 0.0 Arabidopsis thaliana ATP-binding cassette G25, ATP-binding casette G25, ATP-binding casette family G25 (.1) Potri.003G046800 [exp] 53 / 4e-09 AT1G31770 945 / 0.0 ATP-binding cassette G14, ATP-binding cassette 14 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025149 pacid=23167751 polypeptide=Lus10025149 locus=Lus10025149.g ID=Lus10025149.BGIv1.0 annot-version=v1.0 ATGAGTTTTTTCACCGCGACGAAGACGCTTGTCAATGATATCTATGGAGAAGCAAGTGACGGTGAGATTTTGGTCGCTCTCGGACCGAGTGGCTCCGGGA AATCAACTCTGCTCGATGCTCTGGCGAATCGAATTGCAAAAAAATTGTTGAAAGGGAGAGACATTTATGTACGCGACAGAGTTACGGCTCTCGAAGACTC TGTCCACGTCGAAGAACAAGGCTCGAGTCCAGGCGCTGATCGACCAGCTCGGACTCCGGAAAGCCACAAAAATGGTCATCGGAGGCGAAGGCCACCGGGA AGTCTCCGACAGTCGGTGGAGGCAAAGATACCGCCGATGCGGTAG
AA sequence Show only first row Show all	>Lus10025149 pacid=23167751 polypeptide=Lus10025149 locus=Lus10025149.g ID=Lus10025149.BGIv1.0 annot-version=v1.0 MSFFTATKTLVNDIYGEASDGEILVALGPSGSGKSTLLDALANRIAKKLLKGRDIYVRDRVTALEDSVHVEEQGSSPGADRPARTPESHKNGHRRRRPPG SLRQSVEAKIPPMR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10025149 [exp]	0	1
AT2G06090			Plant self-incompatibility pro...		Lus10029389 [exp]	1.0	1.0000
AT3G03470		CYP89A9	"cytochrome P450, family 87, s...		Lus10020361 [exp]	1.4	0.9347
AT2G40170		GEA6, ATEM6	LATE EMBRYOGENESIS ABUNDANT 6,...		Lus10030394 [exp]	3.5	0.8673
AT4G20820			FAD-binding Berberine family p...		Lus10023376 [exp]	9.2	0.8798
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10024050 [exp]	13.0	0.8470
AT1G60830			RNA-binding (RRM/RBD/RNP motif...		Lus10011201 [exp]	13.2	0.7576
AT5G62840			Phosphoglycerate mutase family...		Lus10030165 [exp]	15.0	0.7499
					Lus10033534 [exp]	18.0	0.7685
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10014637 [exp]	19.4	0.7685
					Lus10039990 [exp]	20.8	0.7685

Compare expression of checked genes

Lus10025149 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.