Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55090 52 / 2e-09 ABCG16 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) AT2G39350 52 / 2e-09 ABCG1 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) AT3G55110 40 / 3e-05 ABCG18 ATP-binding cassette G18, ABC-2 type transporter family protein (.1) AT3G55130 39 / 0.0001 ABCG19, ATWBC19 ATP-binding cassette G19, white-brown complex homolog 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023465 [exp] 135 / 2e-38 AT2G39350 1064 / 0.0 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) Lus10040341 [exp] 130 / 4e-37 AT2G39350 452 / 0.0 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) Lus10001971 [exp] 103 / 3e-30 AT3G55090 79 / 3e-18 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Lus10030307 [exp] 102 / 1e-27 AT2G37360 366 / 9e-122 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10025281 [exp] 44 / 3e-06 AT2G37360 1035 / 0.0 ATP-binding cassette G2, ABC-2 type transporter family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G047900 [exp] 96 / 1e-24 AT3G55090 1008 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.010G213400 [exp] 86 / 4e-21 AT3G55090 1014 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.014G080200 [exp] 49 / 4e-08 AT2G37360 955 / 0.0 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Potri.006G215100 [exp] 46 / 5e-07 AT3G53510 860 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) Potri.002G156900 [exp] 43 / 6e-06 AT3G53510 950 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025150 pacid=23167774 polypeptide=Lus10025150 locus=Lus10025150.g ID=Lus10025150.BGIv1.0 annot-version=v1.0 ATGGAACTCACCGATCATCAGCCTCCGCCACCGACATCTTCCCGACATGGAGCCTTATGCCTTTCTCCAACACTCGGCCAGCTTCTGAAGCACGTTGGAG ATGTTCTAAAGGAAGTCACCGGTGATGGAAGCGAAACTCCCGTCCATCACGTGCCCGAGCTCGGGGATTCTAATCCGAAAGTTTCCCGATCGATTCCGTT CGTTCTGTCTTTCAGTAATCTTACTTACACGTTCGCATCCACCGCAAGCTGA
AA sequence Show only first row Show all	>Lus10025150 pacid=23167774 polypeptide=Lus10025150 locus=Lus10025150.g ID=Lus10025150.BGIv1.0 annot-version=v1.0 MELTDHQPPPPTSSRHGALCLSPTLGQLLKHVGDVLKEVTGDGSETPVHHVPELGDSNPKVSRSIPFVLSFSNLTYTFASTAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55090		ABCG16	ATP-binding cassette G16, ABC-...		Lus10025150 [exp]	0	1
					Lus10000529 [exp]	4.8	0.9532
					Lus10005514 [exp]	6.8	0.9532
AT5G05070			DHHC-type zinc finger family p...		Lus10027274 [exp]	8.3	0.9532
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Lus10014005 [exp]	9.6	0.9532
					Lus10002267 [exp]	10.1	0.7440
AT2G04865			Aminotransferase-like, plant m...		Lus10014633 [exp]	10.7	0.9532
AT3G02960			Heavy metal transport/detoxifi...		Lus10015762 [exp]	11.7	0.9532
AT5G27260			unknown protein		Lus10007175 [exp]	12.7	0.9532
					Lus10008001 [exp]	13.6	0.9532
AT3G60730			Plant invertase/pectin methyle...		Lus10015877 [exp]	14.4	0.9532

Compare expression of checked genes

Lus10025150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.