Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 103 / 1e-29 LTP3 lipid transfer protein 3 (.1) AT5G59310 100 / 2e-28 LTP4 lipid transfer protein 4 (.1) AT3G51600 91 / 7e-25 LTP5 lipid transfer protein 5 (.1) AT3G51590 91 / 1e-24 LTP12 lipid transfer protein 12 (.1) AT2G38540 90 / 3e-24 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G01870 87 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G33355 86 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G08770 85 / 2e-22 LTP6 lipid transfer protein 6 (.1.2) AT2G38530 82 / 3e-21 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G15050 81 / 7e-21 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025231 [exp] 199 / 1e-67 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10022745 [exp] 119 / 5e-36 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 118 / 1e-35 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10025234 [exp] 103 / 1e-29 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10015279 [exp] 96 / 1e-26 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10026418 [exp] 93 / 1e-25 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025148 [exp] 91 / 2e-24 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025230 [exp] 89 / 2e-23 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10042210 [exp] 85 / 3e-22 AT5G59320 86 / 6e-23 lipid transfer protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 114 / 3e-34 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 112 / 3e-33 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 91 / 8e-25 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.016G136000 [exp] 89 / 4e-24 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 88 / 1e-23 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G108100 [exp] 85 / 1e-22 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232900 [exp] 81 / 1e-20 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 80 / 2e-20 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.001G232700 [exp] 80 / 2e-20 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G046500 [exp] 80 / 2e-20 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10025151 pacid=23167801 polypeptide=Lus10025151 locus=Lus10025151.g ID=Lus10025151.BGIv1.0 annot-version=v1.0 ATGGCGGCTAGTCAGATATTTGTTACGATGGCGTTCGTCGTCGTCTGCGCACTGACGGTGGCTGCTGGAGCGGACGACGAAGGAATAACGTGTGGTGACG TGGCGATGAGCATGAGGCCATGCGTACCTTACTTGCTGAAAGGTGGTGCCGTGCCGGCGCCGTGCTGCAACGGGTTGAAGTCGCTGAACGAGGCAGCCAA GACAACCGTTGACCGACAAAAGACATGCGAGTGCTTGAAATCGGCGGCGGGTAATATCCCTGACTTGAAGAACGAACTGGCTGCCGCACTCCCAGATGCC TGTGGAGTCCACATTCCGTACGAGTTCACCACCAAGACCGATTGCAACTCGTAA
AA sequence Show only first row Show all	>Lus10025151 pacid=23167801 polypeptide=Lus10025151 locus=Lus10025151.g ID=Lus10025151.BGIv1.0 annot-version=v1.0 MAASQIFVTMAFVVVCALTVAAGADDEGITCGDVAMSMRPCVPYLLKGGAVPAPCCNGLKSLNEAAKTTVDRQKTCECLKSAAGNIPDLKNELAAALPDA CGVHIPYEFTTKTDCNS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10025151 [exp]	0	1
AT3G56800		ACAM-3, CAM3	calmodulin 3 (.1)		Lus10042597 [exp]	1.0	0.8553
AT3G19090			RNA-binding protein (.1)		Lus10012058 [exp]	14.6	0.6676
					Lus10032670 [exp]	19.3	0.7746
AT1G80450			VQ motif-containing protein (....		Lus10026897 [exp]	22.2	0.6236
					Lus10043307 [exp]	27.4	0.7740
AT3G47570			Leucine-rich repeat protein ki...		Lus10035724 [exp]	27.7	0.7731
AT3G03000			EF hand calcium-binding protei...		Lus10004539 [exp]	31.1	0.7720
AT3G22250			UDP-Glycosyltransferase superf...		Lus10031068 [exp]	33.2	0.7053
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	35.0	0.7596
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	37.8	0.7596

Compare expression of checked genes

Lus10025151 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.