Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51590 64 / 7e-14 LTP12 lipid transfer protein 12 (.1) AT2G38530 62 / 7e-13 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G59310 59 / 8e-12 LTP4 lipid transfer protein 4 (.1) AT2G15050 57 / 3e-11 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT5G59320 57 / 5e-11 LTP3 lipid transfer protein 3 (.1) AT2G38540 54 / 6e-10 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G08770 52 / 3e-09 LTP6 lipid transfer protein 6 (.1.2) AT2G18370 49 / 6e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G01870 47 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51600 47 / 3e-07 LTP5 lipid transfer protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025234 [exp] 116 / 4e-34 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10026418 [exp] 85 / 1e-21 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025231 [exp] 68 / 2e-15 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10015278 [exp] 68 / 3e-15 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10022745 [exp] 68 / 3e-15 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025151 [exp] 67 / 5e-15 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10014167 [exp] 66 / 1e-14 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10007280 [exp] 65 / 4e-14 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10029226 [exp] 64 / 1e-13 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 69 / 1e-15 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 62 / 6e-13 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 61 / 2e-12 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 59 / 8e-12 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 57 / 3e-11 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 56 / 1e-10 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232700 [exp] 53 / 2e-09 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 52 / 4e-09 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G046500 [exp] 46 / 5e-07 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.016G135500 [exp] 45 / 1e-06 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025152 pacid=23167885 polypeptide=Lus10025152 locus=Lus10025152.g ID=Lus10025152.BGIv1.0 annot-version=v1.0 ATGGCAGCTGCATTGAAGTTGGTTTCTGTCTTGCTAGTCTGCGCCTTGGTGGCCGCACCCATGACGGTCAGCGGGTTGACCTGCGGGCAAGTGAGCAGCG GGATGGCCCCGTGTCTTACCTATTTGACCGGACGTGCACCAGTCACCGCTGCTTGCTGCAACGGGATGAGGGGACTCCTGCGCATGGCCAAGACCACCGC TGACCGCCGCCAGGCTTGCACCTGCTTGAAAACCGCCGCCGGCAACGTCCCCCCGCCACACCCTCCCTGCGTTGAACCCGGCAATCGCTGCAGGCCTCCC CGGAAAGTGCGGTGTCAACATCCCTTACAAGATCAGCACCTCCACCAACTGCAAAACCATCCAGTGATGACTTTGAACGACGGCGGTGATGTCTACGGTT GGCGTAACTCTGTTGGGTTTTCCTCTGTTTTCTCAGCACTGTCTACTTGA
AA sequence Show only first row Show all	>Lus10025152 pacid=23167885 polypeptide=Lus10025152 locus=Lus10025152.g ID=Lus10025152.BGIv1.0 annot-version=v1.0 MAAALKLVSVLLVCALVAAPMTVSGLTCGQVSSGMAPCLTYLTGRAPVTAACCNGMRGLLRMAKTTADRRQACTCLKTAAGNVPPPHPPCVEPGNRCRPP RKVRCQHPLQDQHLHQLQNHPVMTLNDGGDVYGWRNSVGFSSVFSALST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38530		cdf3, LP2, LTP2	cell growth defect factor-3, l...		Lus10025152 [exp]	0	1
AT5G41460			Protein of unknown function (D...		Lus10017514 [exp]	5.9	0.8511
AT4G25700		BCH1, B1, CHY1,...	BETA CAROTENOID HYDROXYLASE 1,...		Lus10027515 [exp]	7.5	0.8140
AT4G31950		CYP82C3	"cytochrome P450, family 82, s...		Lus10038202 [exp]	17.2	0.7899
AT2G21350			RNA-binding CRS1 / YhbY (CRM) ...		Lus10017965 [exp]	18.0	0.8206
AT5G03250			Phototropic-responsive NPH3 fa...		Lus10023523 [exp]	19.0	0.7968
AT1G72970		HTH, EDA17	HOTHEAD, embryo sac developmen...		Lus10015623 [exp]	19.4	0.7853
AT2G38530		cdf3, LP2, LTP2	cell growth defect factor-3, l...		Lus10025234 [exp]	20.3	0.7932
AT5G02190		EMB24, ATASP38,...	PROMOTION OF CELL SURVIVAL 1, ...		Lus10010854 [exp]	21.2	0.7669
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Lus10038201 [exp]	22.2	0.7632
AT5G45380		ATDUR3	DEGRADATION OF UREA 3, solute:...		Lus10003564 [exp]	23.9	0.7834

Compare expression of checked genes

Lus10025152 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.