Lus10025158 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20810 236 / 2e-78 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G10060 92 / 2e-22 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G18170 42 / 0.0001 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G12340 42 / 0.0004 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016037 391 / 2e-139 AT1G20810 258 / 2e-87 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10035560 83 / 8e-19 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10027729 70 / 6e-14 AT3G10060 285 / 1e-97 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10038954 40 / 0.0006 AT1G18170 193 / 1e-61 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G254900 246 / 2e-82 AT1G20810 272 / 5e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.016G096600 87 / 3e-20 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.001G467100 46 / 8e-06 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G119800 43 / 9e-05 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence
>Lus10025158 pacid=23167771 polypeptide=Lus10025158 locus=Lus10025158.g ID=Lus10025158.BGIv1.0 annot-version=v1.0
ATGGCTTCCATTCCAATTGGGGGGAGCTTAGAGATATACAGGTCTCCCGCCGGGTCAACAACAAATCATTATCATCGCAAATCATGGATGACAACGGCGG
CACTACAAGAGACGGGAGTCGGGTCAAGGAACCAAGTATCCGTATGCACTTCCAGGAGGAAGGCGATGCTCATCGCCACATTGCCGACTTTACTACTGGG
AGCGGTCACGATGCCATCAGCTGAGGCCAGAGAGAGACGCAGCCGCAAGAAGATCCCTCCCGAAGACTATCTCACTAGCCCAGAAGGATTGAAATACTTT
GACATTGAGGAAGGAAAAGGACCCGTCGCCGAGAAAGGATCCACTGTTCTTGTGCATTTTGATTGTATCTACAGAGGAGTCACGGCTGTTTCAAGTCGGG
AGTCTAAGCTGCTTGCTGGAAATCGCATCATTGCTCAGCCATATGAGTTCCAAGTAGGGGCGCCGCCGGGGAAGGAGAGGAAGAGAGAGTTCGTAGACAA
CCCAAATGGTCTCTTCTCAGCACAAGCGTCTCCTAAACCACCGCCTGCAATGTACACCATCACCCAGGGAATGAAAGTTGGAGGAAAGAGGACAGTGATC
GTCCCGCCCGAAGCTGGATATGGAAAAAGGGGATTGTATGAGATTCCACCGAAACTCTGTCCACCTCCAACCCCACATGTTCAGAAGTTGGTCTCGGGAC
TCAGCAGCGGTGGAGAAAACTTAAACAGAAAAGCTTCTAACATCAATTATGCAGTCCTCGGTCTACCAAAAACTCATGAGTAG
AA sequence
>Lus10025158 pacid=23167771 polypeptide=Lus10025158 locus=Lus10025158.g ID=Lus10025158.BGIv1.0 annot-version=v1.0
MASIPIGGSLEIYRSPAGSTTNHYHRKSWMTTAALQETGVGSRNQVSVCTSRRKAMLIATLPTLLLGAVTMPSAEARERRSRKKIPPEDYLTSPEGLKYF
DIEEGKGPVAEKGSTVLVHFDCIYRGVTAVSSRESKLLAGNRIIAQPYEFQVGAPPGKERKREFVDNPNGLFSAQASPKPPPAMYTITQGMKVGGKRTVI
VPPEAGYGKRGLYEIPPKLCPPPTPHVQKLVSGLSSGGENLNRKASNINYAVLGLPKTHE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20810 FKBP-like peptidyl-prolyl cis-... Lus10025158 0 1
AT2G38025 Cysteine proteinases superfami... Lus10027758 3.5 0.8979
AT1G20810 FKBP-like peptidyl-prolyl cis-... Lus10016037 6.0 0.8917
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10020723 11.0 0.7635
AT5G04810 pentatricopeptide (PPR) repeat... Lus10043434 14.8 0.8720
AT4G15510 Photosystem II reaction center... Lus10000352 18.3 0.8706
AT5G25590 Protein of unknown function (D... Lus10000014 18.8 0.8222
AT4G15510 Photosystem II reaction center... Lus10000614 21.6 0.8795
Lus10029097 21.7 0.7994
AT5G27290 unknown protein Lus10018966 22.0 0.8652
AT2G44590 ADL1D DYNAMIN-like 1D (.1.2.3) Lus10030928 28.8 0.8207

Lus10025158 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.