Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05030 64 / 4e-14 Copper transport protein family (.1) AT3G07600 61 / 1e-12 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 57 / 4e-11 Heavy metal transport/detoxification superfamily protein (.1.2) AT1G55790 54 / 1e-09 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2) AT3G20180 51 / 4e-09 Copper transport protein family (.1) AT1G01490 39 / 0.0003 Heavy metal transport/detoxification superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016059 [exp] 180 / 7e-60 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10016060 [exp] 77 / 6e-19 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10025180 [exp] 73 / 2e-17 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016062 [exp] 71 / 8e-17 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025181 [exp] 70 / 3e-16 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016061 [exp] 67 / 3e-15 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016063 [exp] 56 / 9e-11 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10025182 [exp] 56 / 1e-10 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 45 / 3e-06 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G048300 [exp] 69 / 8e-16 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 67 / 2e-15 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048400 [exp] 67 / 4e-15 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 66 / 5e-15 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171300 [exp] 66 / 9e-15 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G468500 [exp] 63 / 1e-13 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.006G001900 [exp] 61 / 2e-13 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.016G002600 [exp] 61 / 2e-13 AT4G05030 72 / 2e-18 Copper transport protein family (.1) Potri.006G001800 [exp] 57 / 8e-12 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.001G378700 [exp] 56 / 8e-11 AT3G20180 56 / 5e-11 Copper transport protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025179 pacid=23167776 polypeptide=Lus10025179 locus=Lus10025179.g ID=Lus10025179.BGIv1.0 annot-version=v1.0 ATGAACGACCAGAAGTCTCGCACTAAAGCATTGAAGATCGCCGTCACTGTTCCAGGAGTTGAGTCAGTGGCTCTAGCAGGAGAAGGCAAAAACGAGATTG TGGTGACGGGCGAAGGGATAGACGCGGTAAAGCTAGCGAGTCTGCTGAGGAAAAGCGTGGGATTTGCTGACGTGTTAAGCGTCGGCGATACTGAATATTA TGCTGACGGCAACAGAATTGCGGCGGCGGCGGCGGATGATGACAGTAATTATGTTGCACAAGGACGGCAGCTGCAGCCAATTGTTTGGGGAAACAATAAT AGTAATTACGGTGGTTTGTTTGATGTGCCTAATGGTTATTATCATAATTACGCAGCATACGATCGCCTGCGTAATTACCAGTGGCCGTGA
AA sequence Show only first row Show all	>Lus10025179 pacid=23167776 polypeptide=Lus10025179 locus=Lus10025179.g ID=Lus10025179.BGIv1.0 annot-version=v1.0 MNDQKSRTKALKIAVTVPGVESVALAGEGKNEIVVTGEGIDAVKLASLLRKSVGFADVLSVGDTEYYADGNRIAAAAADDDSNYVAQGRQLQPIVWGNNN SNYGGLFDVPNGYYHNYAAYDRLRNYQWP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05030			Copper transport protein famil...		Lus10025179 [exp]	0	1
AT2G47540			Pollen Ole e 1 allergen and ex...		Lus10008213 [exp]	1.7	0.8492
AT4G26200		ACS7, ATACS7	1-amino-cyclopropane-1-carboxy...		Lus10008579 [exp]	3.9	0.8603
					Lus10008153 [exp]	6.8	0.8600
AT1G26380			FAD-binding Berberine family p...		Lus10021289 [exp]	9.8	0.8010
					Lus10015230 [exp]	14.5	0.8216
					Lus10010306 [exp]	16.5	0.8024
AT1G65890		AAE12	acyl activating enzyme 12 (.1)		Lus10031367 [exp]	17.1	0.8037
AT1G70780			unknown protein		Lus10009131 [exp]	19.0	0.7809
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	19.0	0.7976
AT1G22430			GroES-like zinc-binding dehydr...		Lus10004785 [exp]	19.8	0.8218

Compare expression of checked genes

Lus10025179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.