Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48290 60 / 3e-12 Heavy metal transport/detoxification superfamily protein (.1.2) AT4G05030 53 / 3e-10 Copper transport protein family (.1) AT3G07600 54 / 4e-10 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016061 [exp] 123 / 7e-38 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016062 [exp] 110 / 8e-33 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025181 [exp] 105 / 8e-31 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016060 [exp] 70 / 1e-16 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10025182 [exp] 61 / 5e-13 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016063 [exp] 60 / 7e-13 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016059 [exp] 52 / 2e-09 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10025179 [exp] 50 / 6e-09 AT4G05030 62 / 1e-13 Copper transport protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G171300 [exp] 74 / 5e-18 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048300 [exp] 73 / 8e-18 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 72 / 2e-17 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048400 [exp] 72 / 2e-17 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 71 / 5e-17 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G001900 [exp] 52 / 2e-10 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.006G001800 [exp] 48 / 1e-08 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.018G023600 [exp] 50 / 3e-08 AT2G20142 86 / 7e-19 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.001G468500 [exp] 48 / 4e-08 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.006G002000 [exp] 42 / 2e-06 AT4G05030 54 / 3e-11 Copper transport protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025180 pacid=23167887 polypeptide=Lus10025180 locus=Lus10025180.g ID=Lus10025180.BGIv1.0 annot-version=v1.0 ATGCCGCAAAAGGTTTTGATCAAGGTGACGATGAACAGCCCGAAGCTGAAAGCCAAGGCCTTGAATGTCGCGGTGGGAGTCAGCGGCGTGGACTCCGCGG CGTTGGCCGGGCCAGACAAGACCCAGATTGAGGTCACCGGCGACGGAGTTGATTCCGTGGAACTCGTCTCTCTGCTCCGGAAGAAGGTTGGGTTTGCGGA TTTGGTCAGCGTCACTCCTGTGGAAGAGAAGAAGAAGGAAGACCCCAAACCGGCGGCAGTCTTGCCGTCGCCGCCGGTTGCCCTTTGGTCGTACGGATAC GCCAACGGCACACCATATTACGTCTATTAG
AA sequence Show only first row Show all	>Lus10025180 pacid=23167887 polypeptide=Lus10025180 locus=Lus10025180.g ID=Lus10025180.BGIv1.0 annot-version=v1.0 MPQKVLIKVTMNSPKLKAKALNVAVGVSGVDSAALAGPDKTQIEVTGDGVDSVELVSLLRKKVGFADLVSVTPVEEKKKEDPKPAAVLPSPPVALWSYGY ANGTPYYVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48290			Heavy metal transport/detoxifi...		Lus10025180 [exp]	0	1
AT1G69550			disease resistance protein (TI...		Lus10018308 [exp]	5.3	0.7661
AT5G51460		ATTPPA	Haloacid dehalogenase-like hyd...		Lus10031723 [exp]	6.2	0.7989
AT2G27410	B3		Domain of unknown function (DU...		Lus10000815 [exp]	7.9	0.6680
AT1G27680		APL2	ADPGLC-PPase large subunit (.1...		Lus10007209 [exp]	10.5	0.7256
AT5G03795			Exostosin family protein (.1)		Lus10039142 [exp]	10.8	0.7056
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10018381 [exp]	11.0	0.7475
AT1G27170			transmembrane receptors;ATP bi...		Lus10020524 [exp]	13.7	0.7604
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Lus10021185 [exp]	14.3	0.7521
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10039344 [exp]	17.0	0.7483
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10018380 [exp]	17.0	0.7285

Compare expression of checked genes

Lus10025180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.