Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07600 58 / 2e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 58 / 3e-11 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G20180 52 / 1e-09 Copper transport protein family (.1) AT4G05030 41 / 3e-05 Copper transport protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016063 [exp] 155 / 5e-50 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016062 [exp] 100 / 2e-28 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025181 [exp] 100 / 2e-28 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016061 [exp] 97 / 3e-27 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025180 [exp] 89 / 5e-24 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016060 [exp] 86 / 3e-22 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016059 [exp] 58 / 1e-11 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10025179 [exp] 58 / 1e-11 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10014967 [exp] 46 / 8e-07 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G048400 [exp] 81 / 1e-20 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 80 / 2e-20 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171300 [exp] 77 / 2e-19 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048300 [exp] 77 / 2e-19 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 74 / 4e-18 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G001900 [exp] 55 / 4e-11 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.018G023600 [exp] 55 / 7e-10 AT2G20142 86 / 7e-19 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.001G378700 [exp] 50 / 8e-09 AT3G20180 56 / 5e-11 Copper transport protein family (.1) Potri.006G001800 [exp] 47 / 6e-08 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.017G145516 [exp] 42 / 6e-06 AT1G01490 56 / 7e-11 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025182 pacid=23167825 polypeptide=Lus10025182 locus=Lus10025182.g ID=Lus10025182.BGIv1.0 annot-version=v1.0 ATGAAGCAAAAGATAGTGATCAATCTGCCGACGGTTAGCAACCAGAAGTCGAGATCCAAGGCGATGAATATAGCGGTCGGGGTCGACTGCGTGAATTCCG CGTCGTGGGCCGGGCCGGAGAAGACCCAACTTGAGGTCGCCGGTGACGGAATCGATCCTGTGAGGCTAGTGTGTCTGCTTCGGAAAAAGTTTGGATCTGC GGAGTTGGAAACCGTGGCTCCTGTGGAAGAGAAGAAGGATGATAAGAAGAAGGATGATAAGAAGAAGGATGATAAGAAGAAGGATGACTGTTGTAAACCG TGTGCGGAAGGGTGGCCGTGGACGTCGCCGACCATTTGGCCCTACGGATGTGTCTGCTGCCCACCGTACTACTAG
AA sequence Show only first row Show all	>Lus10025182 pacid=23167825 polypeptide=Lus10025182 locus=Lus10025182.g ID=Lus10025182.BGIv1.0 annot-version=v1.0 MKQKIVINLPTVSNQKSRSKAMNIAVGVDCVNSASWAGPEKTQLEVAGDGIDPVRLVCLLRKKFGSAELETVAPVEEKKDDKKKDDKKKDDKKKDDCCKP CAEGWPWTSPTIWPYGCVCCPPYY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48290			Heavy metal transport/detoxifi...		Lus10025182 [exp]	0	1
					Lus10034388 [exp]	1.0	0.9477
AT5G10770			Eukaryotic aspartyl protease f...		Lus10020100 [exp]	1.7	0.9264
AT2G42005			Transmembrane amino acid trans...		Lus10013835 [exp]	2.0	0.9271
AT5G03170		ATFLA11, FLA11,...	ARABIDOPSIS FASCICLIN-LIKE ARA...		Lus10002984 [exp]	4.9	0.9216
AT2G36640		ATECP63	embryonic cell protein 63 (.1)		Lus10035586 [exp]	5.5	0.8835
					Lus10011342 [exp]	6.9	0.8753
AT5G10760			Eukaryotic aspartyl protease f...		Lus10026906 [exp]	8.7	0.8511
AT5G03170		ATFLA11, FLA11,...	ARABIDOPSIS FASCICLIN-LIKE ARA...		Lus10036112 [exp]	10.5	0.8995
AT1G58340		BCD1, ZRZ, ZF14	ZRIZI, BUSH-AND-CHLOROTIC-DWAR...		Lus10007231 [exp]	10.6	0.8907
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10011288 [exp]	12.8	0.8785

Compare expression of checked genes

Lus10025182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.