Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67440 263 / 3e-85 MEL2, NPY3 NAKED PINS IN YUC MUTANTS 3, MAB4/ENP/NPY1-LIKE 2, Phototropic-responsive NPH3 family protein (.1.2) AT4G37590 259 / 2e-83 MEL1, NPY5 NAKED PINS IN YUC MUTANTS 5, MAB4/ENP/NPY1-LIKE 1, Phototropic-responsive NPH3 family protein (.1) AT4G31820 249 / 1e-79 MAB4, ENP, NPY1 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) AT2G14820 249 / 3e-79 MEL3, NPY2 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) AT2G23050 222 / 3e-70 MEL4, NPY4 NAKED PINS IN YUC MUTANTS 4, MAB4/ENP/NPY1-LIKE 4, Phototropic-responsive NPH3 family protein (.1) AT1G67900 171 / 1e-49 Phototropic-responsive NPH3 family protein (.1.2.3) AT5G64330 167 / 1e-48 JK218, RPT3, NPH3 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) AT5G47800 162 / 9e-47 Phototropic-responsive NPH3 family protein (.1) AT5G03250 153 / 2e-43 Phototropic-responsive NPH3 family protein (.1) AT1G30440 148 / 3e-41 Phototropic-responsive NPH3 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033796 [exp] 285 / 3e-93 AT2G14820 735 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10014632 [exp] 282 / 4e-92 AT2G14820 741 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10011525 [exp] 274 / 3e-89 AT4G37590 579 / 0.0 NAKED PINS IN YUC MUTANTS 5, MAB4/ENP/NPY1-LIKE 1, Phototropic-responsive NPH3 family protein (.1) Lus10019297 [exp] 262 / 8e-85 AT4G37590 569 / 0.0 NAKED PINS IN YUC MUTANTS 5, MAB4/ENP/NPY1-LIKE 1, Phototropic-responsive NPH3 family protein (.1) Lus10042414 [exp] 256 / 6e-82 AT4G31820 612 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Lus10026255 [exp] 257 / 1e-79 AT4G31820 557 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Lus10039099 [exp] 183 / 4e-54 AT5G47800 655 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10000443 [exp] 177 / 5e-52 AT1G67900 797 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Lus10038763 [exp] 176 / 9e-52 AT5G47800 612 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G146400 [exp] 310 / 1e-102 AT2G14820 671 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.001G295600 [exp] 282 / 3e-92 AT2G14820 771 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.009G089500 [exp] 281 / 1e-91 AT2G14820 732 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.018G018600 [exp] 255 / 1e-81 AT4G31820 630 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Potri.006G264300 [exp] 244 / 1e-77 AT4G31820 623 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Potri.016G003700 [exp] 180 / 2e-53 AT5G47800 705 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.008G186100 [exp] 180 / 3e-53 AT1G67900 833 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Potri.007G112600 [exp] 180 / 1e-52 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Potri.006G003000 [exp] 178 / 1e-52 AT5G47800 692 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.017G048200 [exp] 177 / 6e-52 AT5G64330 993 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0033 [flax] [poplar] POZ PF00651 [flax] [poplar] BTB BTB/POZ domain CL0033 [flax] [poplar] PF03000 [flax] [poplar] NPH3 NPH3 family
Representative CDS sequence Show only first row Show all	>Lus10025193 pacid=23167755 polypeptide=Lus10025193 locus=Lus10025193.g ID=Lus10025193.BGIv1.0 annot-version=v1.0 ATGCCGGACTCGTTCGTGGTATGTGAATTGGCTAGTGACATAATAGTGAATGTTAGGGATGTGAAATTCTATCTGCACAAGTTCCCACTATTGTCCAAGA GCTCCCTTCTCCAGAAGTTGGTGGCAAACTCAAACGATGAGAGCAGAGAAGAAATCCACATCCATGATATTCCGGGCGGACCTTGTGCATTTGAGATATG TGCAAAGTTCTGTTATGGTATGACAGTCACCCTGAATGCATACAATGTGATTGCAGCCCGGTGTGCAGCTGAGTATCTTGAGATGTATGAATCTGTTGGG AAAGGGAACCTTGTCTACAAGATTGAAGTCTTTCTCAACTCTAGCATTTTCAGGAGCTGGAAGGACTCCATCATTGTTCTTCAATCTACCACATCTTTTC TTCCATGGTCCGAGGACTTGAAGCTGGTCAGTCGCTGCGTTGACTCTGTAGCTTTGAAAGCTTGCATCGACACTTGCAGGGTGGATTGGTCGTATACCTA TAACAGGAAGAAGCTTCCATCTGAGAATGGGATGGATCCTTATTCGAACAGTGCTAGAAAACCCAACGAGGTTCCTAAAGATTGGTGGGTTGAGGACTTA TGTGAGCTTCAGATTGATCTATACAAAAAGATAATCACAGCCATAAAAAAAAGGGAAAATAGTTGA
AA sequence Show only first row Show all	>Lus10025193 pacid=23167755 polypeptide=Lus10025193 locus=Lus10025193.g ID=Lus10025193.BGIv1.0 annot-version=v1.0 MPDSFVVCELASDIIVNVRDVKFYLHKFPLLSKSSLLQKLVANSNDESREEIHIHDIPGGPCAFEICAKFCYGMTVTLNAYNVIAARCAAEYLEMYESVG KGNLVYKIEVFLNSSIFRSWKDSIIVLQSTTSFLPWSEDLKLVSRCVDSVALKACIDTCRVDWSYTYNRKKLPSENGMDPYSNSARKPNEVPKDWWVEDL CELQIDLYKKIITAIKKRENS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G67440		MEL2, NPY3	NAKED PINS IN YUC MUTANTS 3, M...		Lus10025193 [exp]	0	1
AT5G49330	MYB	PFG3, ATMYB111	PRODUCTION OF FLAVONOL GLYCOSI...		Lus10000008 [exp]	1.4	1.0000
					Lus10001123 [exp]	2.4	1.0000
AT1G54130		AT-RSH3, RSH3, ...	RELA/SPOT homolog 3 (.1)		Lus10011252 [exp]	2.8	1.0000
					Lus10023352 [exp]	3.2	1.0000
AT1G47550		SEC3A	exocyst complex component sec3...		Lus10001022 [exp]	3.2	1.0000
					Lus10026785 [exp]	3.5	1.0000
					Lus10024677 [exp]	3.6	0.9907
					Lus10018846 [exp]	3.9	0.9092
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029384 [exp]	4.0	1.0000
AT3G14040			Pectin lyase-like superfamily ...		Lus10039150 [exp]	4.9	1.0000

Compare expression of checked genes

Lus10025193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.