Lus10025204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10025204 pacid=23167785 polypeptide=Lus10025204 locus=Lus10025204.g ID=Lus10025204.BGIv1.0 annot-version=v1.0
ATGAGTTATTACAACAACCAGCAGCCACAGCCACCTGTCGGAGTCCCTCCTCCTCAAGGGTACCCGAAAGATGCATACCCACCGCAAGGATACCCAGTAC
AGGGGTATCCTCCTCAGGGGTATCCTCAACAGCAAGGGTATCCTCCGCAGCAGGGTTATCCTCCTCAGCAATACGGTCAGGCTCCTCCCAGGAAAGAAGT
TGGCTTCCTTGAAGGATGGTCACTTAGCGGCCTTATGCTGTTGTTGCATGCTGGATGCTTGTTTCTGAAGTGGAGGGATGCTACGAAGCTGGCACTGGTT
CTATTCCAGCTTGATGTTTGA
AA sequence
>Lus10025204 pacid=23167785 polypeptide=Lus10025204 locus=Lus10025204.g ID=Lus10025204.BGIv1.0 annot-version=v1.0
MSYYNNQQPQPPVGVPPPQGYPKDAYPPQGYPVQGYPPQGYPQQQGYPPQQGYPPQQYGQAPPRKEVGFLEGWSLSGLMLLLHAGCLFLKWRDATKLALV
LFQLDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025204 0 1
AT2G33150 PED1, KAT2, PKT... PEROXISOME DEFECTIVE 1, 3-KETO... Lus10022812 1.0 0.9548
AT2G22905 Expressed protein (.1) Lus10012094 1.7 0.9390
AT4G33920 Protein phosphatase 2C family ... Lus10002110 2.4 0.9430
AT2G23810 TET8 tetraspanin8 (.1) Lus10008891 3.2 0.9110
AT4G11610 NTRB, ATNTRB C2 calcium/lipid-binding plant... Lus10018839 4.9 0.9078
AT4G33920 Protein phosphatase 2C family ... Lus10013896 5.3 0.9311
AT3G20410 CPK9 calmodulin-domain protein kina... Lus10040071 5.3 0.8999
AT2G46330 ATAGP16, AGP16 arabinogalactan protein 16 (.1... Lus10024263 6.7 0.9261
AT4G28400 Protein phosphatase 2C family ... Lus10028094 7.5 0.9186
AT5G50600 ATHSD1 hydroxysteroid dehydrogenase 1... Lus10032556 7.6 0.8472

Lus10025204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.