Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27960 124 / 9e-38 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G64230 123 / 9e-38 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G53300 120 / 4e-37 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G41700 121 / 5e-37 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 119 / 4e-36 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT2G16740 112 / 3e-33 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 107 / 3e-31 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT3G08700 97 / 2e-27 UBC12 ubiquitin-conjugating enzyme 12 (.1) AT3G13550 71 / 1e-16 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2) AT5G62540 66 / 5e-15 UBC3 ubiquitin-conjugating enzyme 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022726 [exp] 124 / 5e-38 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10021385 [exp] 124 / 5e-38 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 124 / 5e-38 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10039323 [exp] 122 / 5e-37 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014942 [exp] 122 / 5e-37 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 122 / 5e-37 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 122 / 5e-37 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10033937 [exp] 121 / 1e-36 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10032352 [exp] 121 / 1e-36 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G131400 [exp] 122 / 5e-37 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.003G136200 [exp] 122 / 5e-37 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 122 / 5e-37 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.001G094900 [exp] 121 / 1e-36 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.012G033000 [exp] 121 / 1e-36 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.015G023300 [exp] 121 / 1e-36 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.016G138900 [exp] 120 / 1e-36 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.004G175000 [exp] 119 / 4e-36 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.001G471200 [exp] 115 / 1e-34 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.011G168200 [exp] 115 / 1e-34 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [flax] [poplar] UBC PF00179 [flax] [poplar] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Lus10025212 pacid=23157337 polypeptide=Lus10025212 locus=Lus10025212.g ID=Lus10025212.BGIv1.0 annot-version=v1.0 ATGGCTTCCACGCGTATCCTCAAGGAGTTCAAGGATTTGCAGAAGGATCCTCCCTCTTCCTGCAGCGCAGGTCCTGTGGTGGAGGACATGTTCCACTGGC AGGCAACGTTCATGGGACCCTCTGACAGTCCTTATTCTGGAGGTGTTTTCCTGGTTAAAATACATTTCCCTCCAGATTATCCTTTCAAGCCTCCCAAGGA CCAAGGTCTTTCCTTCATGGGAGTTTTTCTTGATATCCTGAATGAGCAATGGAGCCCGGCTCTTACCATTTCAAAGGTGTGA
AA sequence Show only first row Show all	>Lus10025212 pacid=23157337 polypeptide=Lus10025212 locus=Lus10025212.g ID=Lus10025212.BGIv1.0 annot-version=v1.0 MASTRILKEFKDLQKDPPSSCSAGPVVEDMFHWQATFMGPSDSPYSGGVFLVKIHFPPDYPFKPPKDQGLSFMGVFLDILNEQWSPALTISKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27960		UBC9	ubiquitin conjugating enzyme 9...		Lus10025212 [exp]	0	1
AT4G29270			HAD superfamily, subfamily III...		Lus10011140 [exp]	14.8	0.6300
AT1G20780		ATPUB44, SAUL1	ARABIDOPSIS THALIANA PLANT U-B...		Lus10030224 [exp]	15.4	0.6255
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Lus10041487 [exp]	20.8	0.5808
AT3G13670			Protein kinase family protein ...		Lus10013737 [exp]	21.1	0.6179
AT5G42940			RING/U-box superfamily protein...		Lus10024810 [exp]	30.1	0.6170
AT5G10560			Glycosyl hydrolase family prot...		Lus10019240 [exp]	43.1	0.5105
AT1G49230			RING/U-box superfamily protein...		Lus10005814 [exp]	52.5	0.5524
AT1G30755			Protein of unknown function (D...		Lus10013553 [exp]	74.1	0.5384
AT5G58430		ATEXO70B1	exocyst subunit exo70 family p...		Lus10011859 [exp]	80.1	0.5305
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10017263 [exp]	100.7	0.5021

Compare expression of checked genes

Lus10025212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.