Lus10025228 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01880 97 / 5e-26 RING/U-box superfamily protein (.1)
AT3G10910 87 / 5e-22 RING/U-box superfamily protein (.1)
AT5G05280 85 / 3e-21 RING/U-box superfamily protein (.1)
AT1G72310 84 / 6e-20 ATL3 RING/U-box superfamily protein (.1)
AT4G17905 79 / 3e-18 ATL4H RING/U-box superfamily protein (.1)
AT3G18773 77 / 4e-18 RING/U-box superfamily protein (.1)
AT1G49230 77 / 4e-18 RING/U-box superfamily protein (.1)
AT2G17450 76 / 8e-18 RHA3A RING-H2 finger A3A (.1)
AT1G76410 76 / 1e-17 ATL8 RING/U-box superfamily protein (.1)
AT1G49210 76 / 2e-17 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025145 222 / 1e-75 AT5G01880 96 / 6e-26 RING/U-box superfamily protein (.1)
Lus10025144 146 / 1e-45 AT5G01880 87 / 5e-22 RING/U-box superfamily protein (.1)
Lus10025146 100 / 1e-27 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1)
Lus10036380 97 / 5e-26 AT5G05280 96 / 2e-25 RING/U-box superfamily protein (.1)
Lus10022743 93 / 2e-24 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10029037 87 / 6e-22 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10005818 84 / 3e-21 AT1G49230 140 / 1e-42 RING/U-box superfamily protein (.1)
Lus10005816 84 / 1e-20 AT1G49230 169 / 5e-53 RING/U-box superfamily protein (.1)
Lus10005814 84 / 2e-20 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G136200 97 / 5e-26 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.013G091300 92 / 5e-24 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.003G075200 86 / 7e-22 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Potri.001G159300 85 / 2e-21 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Potri.019G057700 85 / 3e-21 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.005G099000 83 / 2e-20 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Potri.019G010500 83 / 3e-20 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Potri.001G309600 83 / 4e-20 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.007G064401 82 / 4e-20 AT1G20823 118 / 2e-33 RING/U-box superfamily protein (.1)
Potri.013G157000 80 / 2e-19 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10025228 pacid=23157334 polypeptide=Lus10025228 locus=Lus10025228.g ID=Lus10025228.BGIv1.0 annot-version=v1.0
ATGACACGAATCCACGCATGGCCCGGTGAGTCCGAGGAAGCCGCTCGAGTCGCTTGGGAGCAGGCGTATCTCCGGAAACACTGGAGGACGGTACTGGTTG
AGGTGCTCGTCTGTCTCGTGATTTTTGCTGGGGTGTTCTTCATCAAGCACTGCGTGAAGAAATGTCGGAAGAAGCATTGTGTGAGGCGGCAGATCCGGGT
CGCCGCTCACGGGTCGGGTCCTCCCGCCCGGGTGGTGGTGGTGAGTGGTGAGTGCTCCATTTGTTTGGGGGAGTTCTTGGACGGGGAGAGGGTTCGGGTG
CTGCCCAAGTGCAATCACGAGTTTCATGTTTTGTGCATCGACAAGTGGCTTGCGTCGCACTCTTCCTGCCCCAACTGTCGCCATTCAGTCGTCGGCGGCG
AGCTTCAGAGGCTCCCGGAGAATATTGTTCGGCAAGGGTTGACGACTTAA
AA sequence
>Lus10025228 pacid=23157334 polypeptide=Lus10025228 locus=Lus10025228.g ID=Lus10025228.BGIv1.0 annot-version=v1.0
MTRIHAWPGESEEAARVAWEQAYLRKHWRTVLVEVLVCLVIFAGVFFIKHCVKKCRKKHCVRRQIRVAAHGSGPPARVVVVSGECSICLGEFLDGERVRV
LPKCNHEFHVLCIDKWLASHSSCPNCRHSVVGGELQRLPENIVRQGLTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G01880 RING/U-box superfamily protein... Lus10025228 0 1
AT4G31140 O-Glycosyl hydrolases family 1... Lus10024535 1.0 0.8627
AT5G67420 AS2 ASL39, LBD37 ASYMMETRIC LEAVES2-LIKE 39, LO... Lus10018697 3.9 0.7455
AT1G62760 Plant invertase/pectin methyle... Lus10028910 6.9 0.7779
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Lus10001133 10.1 0.7974
Lus10000914 10.6 0.7358
AT2G39530 Uncharacterised protein family... Lus10031305 11.2 0.7358
AT5G47740 Adenine nucleotide alpha hydro... Lus10019487 11.8 0.7386
AT5G17980 C2 calcium/lipid-binding plant... Lus10010658 13.1 0.7937
AT3G04290 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) Lus10036966 14.7 0.7253
AT4G25350 SHB1 SHORT HYPOCOTYL UNDER BLUE1, E... Lus10037146 15.7 0.7167

Lus10025228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.