Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 99 / 5e-28 LTP3 lipid transfer protein 3 (.1) AT5G59310 97 / 3e-27 LTP4 lipid transfer protein 4 (.1) AT2G38540 91 / 8e-25 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51590 90 / 4e-24 LTP12 lipid transfer protein 12 (.1) AT3G51600 87 / 5e-23 LTP5 lipid transfer protein 5 (.1) AT3G08770 84 / 4e-22 LTP6 lipid transfer protein 6 (.1.2) AT4G33355 84 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G38530 83 / 1e-21 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G01870 82 / 3e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 80 / 2e-20 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025151 [exp] 199 / 1e-67 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10022745 [exp] 116 / 2e-34 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 115 / 3e-34 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10025234 [exp] 100 / 4e-28 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10015279 [exp] 89 / 6e-24 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10015278 [exp] 88 / 1e-23 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10026418 [exp] 87 / 7e-23 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025148 [exp] 87 / 7e-23 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10000082 [exp] 85 / 3e-22 AT2G38540 88 / 2e-23 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 103 / 1e-29 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 102 / 4e-29 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 84 / 6e-22 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.016G136000 [exp] 84 / 1e-21 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G108100 [exp] 83 / 2e-21 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135800 [exp] 82 / 3e-21 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 81 / 6e-21 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 81 / 1e-20 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 78 / 1e-19 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.014G046500 [exp] 75 / 2e-18 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10025231 pacid=23157363 polypeptide=Lus10025231 locus=Lus10025231.g ID=Lus10025231.BGIv1.0 annot-version=v1.0 ATGGAGGCTAGTCATATATTTGTTACAATGCTCCTCGTCGTCGGCGCACTGACAGTGGCTACTGGAGCGGACGACGGAGGAATAACGTGCGGTGAAGTGG CGATGAGCATGAGGCCATGCGTACCTTACTTGCTAAAAGGTGGTCCCGTGCCGGCACCGTGCTGCAGCGGGATGAGGTCACTGAACGAGGCAGCCAAGAC AACCGTTGATCAACAAAAGACTTGCGAGTGCTTGAAATCGGCGGCGGATAATATCCCTGACTTGAAGAACGAACTCGCTGCCGCACTCCCAGATGCCTGT GGGGTCGACTTTCCGTACGAGTTCACCACCAAGACCGACTGCAATTCTGTGTTTTGTTCTGATCGTCGTGGCAGCATCGAGTAA
AA sequence Show only first row Show all	>Lus10025231 pacid=23157363 polypeptide=Lus10025231 locus=Lus10025231.g ID=Lus10025231.BGIv1.0 annot-version=v1.0 MEASHIFVTMLLVVGALTVATGADDGGITCGEVAMSMRPCVPYLLKGGPVPAPCCSGMRSLNEAAKTTVDQQKTCECLKSAADNIPDLKNELAAALPDAC GVDFPYEFTTKTDCNSVFCSDRRGSIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10025231 [exp]	0	1
					Lus10040269 [exp]	1.0	0.9470
AT4G33940			RING/U-box superfamily protein...		Lus10014366 [exp]	4.0	0.8546
AT3G11900		ANT1	aromatic and neutral transport...		Lus10017224 [exp]	4.2	0.8343
ATCG00490		ATCG00490.1, RB...	ribulose-bisphosphate carboxyl...		Lus10032825 [exp]	4.5	0.8756
AT5G52250		EFO1, RUP1	REPRESSOR OF UV-B PHOTOMORPHOG...		Lus10005742 [exp]	4.9	0.8624
AT5G44785		OSB3	organellar single-stranded DNA...		Lus10002722 [exp]	6.9	0.8250
ATCG00120		ATCG00120.1, AT...	ATP synthase subunit alpha (.1...		Lus10004894 [exp]	8.4	0.8460
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Lus10032827 [exp]	11.8	0.8264
AT1G73190		ALPHA-TIP, TIP3...	ALPHA-TONOPLAST INTRINSIC PROT...		Lus10042375 [exp]	12.0	0.8014
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Lus10009173 [exp]	14.4	0.8203

Compare expression of checked genes

Lus10025231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.