Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06220 60 / 2e-12 GFA1, CLO, MEE5 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) AT5G25230 46 / 3e-07 Ribosomal protein S5/Elongation factor G/III/V family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043477 [exp] 88 / 5e-22 AT1G06220 828 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) Lus10034111 [exp] 87 / 7e-22 AT1G06220 1761 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) Lus10031129 [exp] 82 / 7e-20 AT1G06220 1751 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G190600 [exp] 72 / 2e-16 AT1G06220 1744 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) Potri.018G114900 [exp] 71 / 5e-16 AT1G06220 1710 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025233 pacid=23157307 polypeptide=Lus10025233 locus=Lus10025233.g ID=Lus10025233.BGIv1.0 annot-version=v1.0 ATGGATGATAATCTGTATGATGAGTTTGGGAATTACATTGGTCCGGAAATCAAGTTTGACCACGAGAGTGACGAGGAGGGAGATGAGACCTTCAAGACAG GCTTCATGAAGATGAGGCTAAAGGAGGAGGCAGGGAATGCTTCCAATGGTTGGCTGACAGCATCTGGCGATGTAGATATGGACAATCAGATTGTTCTTGC TGAGGATAAGAAGTAG
AA sequence Show only first row Show all	>Lus10025233 pacid=23157307 polypeptide=Lus10025233 locus=Lus10025233.g ID=Lus10025233.BGIv1.0 annot-version=v1.0 MDDNLYDEFGNYIGPEIKFDHESDEEGDETFKTGFMKMRLKEEAGNASNGWLTASGDVDMDNQIVLAEDKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06220		GFA1, CLO, MEE5	MATERNAL EFFECT EMBRYO ARREST ...		Lus10025233 [exp]	0	1
AT2G15220			Plant basic secretory protein ...		Lus10019802 [exp]	36.6	0.5568
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Lus10009726 [exp]	37.1	0.5548
					Lus10017627 [exp]	60.5	0.5420
AT2G22070			pentatricopeptide (PPR) repeat...		Lus10019689 [exp]	63.0	0.5488
					Lus10010245 [exp]	69.6	0.5538
AT2G03360			Glycosyltransferase family 61 ...		Lus10037124 [exp]	71.5	0.5281
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10026128 [exp]	73.5	0.5344
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	92.5	0.5202
					Lus10039432 [exp]	93.0	0.5202
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	93.5	0.5202

Compare expression of checked genes

Lus10025233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.