Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38530 118 / 2e-35 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G38540 107 / 3e-31 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59320 107 / 3e-31 LTP3 lipid transfer protein 3 (.1) AT5G59310 103 / 8e-30 LTP4 lipid transfer protein 4 (.1) AT3G51590 103 / 1e-29 LTP12 lipid transfer protein 12 (.1) AT2G15050 101 / 7e-29 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51600 86 / 8e-23 LTP5 lipid transfer protein 5 (.1) AT4G33355 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G01870 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 71 / 5e-17 LTP6 lipid transfer protein 6 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026418 [exp] 162 / 7e-53 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10022745 [exp] 111 / 1e-32 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 107 / 4e-31 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10015278 [exp] 103 / 5e-30 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10025151 [exp] 103 / 1e-29 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10025231 [exp] 100 / 4e-28 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10007280 [exp] 96 / 7e-27 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10029226 [exp] 94 / 1e-25 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10015279 [exp] 92 / 4e-25 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 114 / 4e-34 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 108 / 7e-32 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.004G086500 [exp] 107 / 2e-31 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.006G108100 [exp] 101 / 5e-29 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 98 / 1e-27 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 95 / 2e-26 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G046500 [exp] 76 / 7e-19 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.016G135500 [exp] 75 / 2e-18 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G135700 [exp] 69 / 4e-16 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.001G232900 [exp] 67 / 2e-15 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10025234 pacid=23157420 polypeptide=Lus10025234 locus=Lus10025234.g ID=Lus10025234.BGIv1.0 annot-version=v1.0 ATGGCAGCTGCATTGAAGTTGGTTTCTATCTTGCTAGTCTGCGCCTTGGTGGCTGCACCCATTACGGTCAGCGGGTTGACCTGCGGGCAAGTGAGCAGCG GGATGGCCGCTTGCCTTACCTATTTGACCGGTCGAGCACCAGTCACCCCTGCTTGCTGCAACGGGATGAGGGGACTCCTCAACATGGCCAAGACCACCGC TGACCGCCGCCTGGCTTGCACCTGCTTGAAAACCGCCGCCGGCAACGTCCCTGGGTTGAATCCGGCAATCGCTGCTGGTCTCCCAGGAAAGTGCGGTGTC AAGATTCCGTATAAGATCAGCACCTCCACCAACTGCAACACGTACGTATTACTTTAA
AA sequence Show only first row Show all	>Lus10025234 pacid=23157420 polypeptide=Lus10025234 locus=Lus10025234.g ID=Lus10025234.BGIv1.0 annot-version=v1.0 MAAALKLVSILLVCALVAAPITVSGLTCGQVSSGMAACLTYLTGRAPVTPACCNGMRGLLNMAKTTADRRLACTCLKTAAGNVPGLNPAIAAGLPGKCGV KIPYKISTSTNCNTYVLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38530		cdf3, LP2, LTP2	cell growth defect factor-3, l...		Lus10025234 [exp]	0	1
AT1G72970		HTH, EDA17	HOTHEAD, embryo sac developmen...		Lus10015623 [exp]	2.0	0.8611
AT2G21350			RNA-binding CRS1 / YhbY (CRM) ...		Lus10017965 [exp]	4.5	0.8808
AT1G62760			Plant invertase/pectin methyle...		Lus10031132 [exp]	12.2	0.8342
AT5G41460			Protein of unknown function (D...		Lus10017514 [exp]	13.9	0.8402
AT2G38530		cdf3, LP2, LTP2	cell growth defect factor-3, l...		Lus10025152 [exp]	20.3	0.7932
AT3G54820		PIP2D, PIP2;5	PLASMA MEMBRANE INTRINSIC PROT...		Lus10023515 [exp]	20.6	0.8561
AT5G42800		M318, TT3, DFR	dihydroflavonol 4-reductase (....		Lus10041031 [exp]	23.8	0.7839
AT5G28750			Bacterial sec-independent tran...		Lus10006588 [exp]	24.8	0.8117
AT5G20950			Glycosyl hydrolase family prot...		Lus10010657 [exp]	27.7	0.8077
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Lus10021901 [exp]	36.4	0.8111

Compare expression of checked genes

Lus10025234 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.