Lus10025242 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11340 164 / 3e-47 S-locus lectin protein kinase family protein (.1)
AT4G23180 155 / 1e-44 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
AT1G11410 154 / 8e-44 S-locus lectin protein kinase family protein (.1)
AT1G65790 148 / 1e-41 ARK1 receptor kinase 1 (.1)
AT1G65800 147 / 2e-41 ARK2 receptor kinase 2 (.1)
AT4G23150 145 / 4e-41 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1)
AT4G21380 145 / 1e-40 ARK3 receptor kinase 3 (.1)
AT4G00970 144 / 2e-40 CRK41 cysteine-rich RLK (RECEPTOR-like protein kinase) 41 (.1)
AT4G23140 142 / 9e-40 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2)
AT4G23230 139 / 4e-39 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005137 350 / 8e-125 AT1G11340 225 / 1e-68 S-locus lectin protein kinase family protein (.1)
Lus10007604 263 / 9e-84 AT1G11340 694 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10013910 245 / 4e-77 AT1G11340 628 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10007610 232 / 5e-72 AT1G11410 693 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10005053 218 / 3e-68 AT1G11410 299 / 1e-90 S-locus lectin protein kinase family protein (.1)
Lus10041679 168 / 6e-50 AT1G11340 417 / 1e-137 S-locus lectin protein kinase family protein (.1)
Lus10024064 171 / 9e-50 AT1G11340 735 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10013245 167 / 4e-48 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
Lus10034637 166 / 4e-48 AT1G11340 660 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G035850 177 / 1e-54 AT4G23270 397 / 6e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1)
Potri.011G036100 182 / 7e-54 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G035800 179 / 1e-52 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G036400 178 / 2e-52 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G036600 178 / 2e-52 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G036466 166 / 2e-50 AT1G11340 411 / 1e-136 S-locus lectin protein kinase family protein (.1)
Potri.004G028400 158 / 1e-49 AT4G23140 206 / 3e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2)
Potri.004G028532 158 / 1e-49 AT4G23140 205 / 9e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2)
Potri.004G028300 164 / 2e-47 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028701 157 / 5e-45 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10025242 pacid=23157359 polypeptide=Lus10025242 locus=Lus10025242.g ID=Lus10025242.BGIv1.0 annot-version=v1.0
ATGGCTAGAATTCTGGACAGCAACCGGATTGATGAGAAGGCCAGCAGAGTGTGTGTGGAACACGGTTATATGTCACCAGAGTATGTAATCTTCGGAAGGT
ATTCAGCGAAACTCGATGTCTACAGCTTTGGGGTGATATTGCTCGAAACAATCACCGGGAAGAAGATCACCGGGTTCTTCCATGAAGATCCTTCCCTGAG
CCTGATCTGCCATGTGTGGGAGCTATGGCGGGCAGGTAGAGCCACCGAGGCAATCGATCCGTCAATATCAATCAAACACTCCTCCCCGAACGAGGTGCTG
CGGTGCATCCAAATCGGACTATTGTGCGTGGAGGAAAATGCAGCGGACCGACCCGATATGTTGTCAGTGGTTCTCATGTTGAACAGCGAAACCACGCCTG
TCCCATCTCCCCAAAAACCTGCGTTTGTTGCTTCTGTGAAACCCAAGCTACCATTGACGAAAGAACAGACGACCTATTCCCTAAACGAGATGTCGTTCTC
AGGGATCCTTAGTCGTTGA
AA sequence
>Lus10025242 pacid=23157359 polypeptide=Lus10025242 locus=Lus10025242.g ID=Lus10025242.BGIv1.0 annot-version=v1.0
MARILDSNRIDEKASRVCVEHGYMSPEYVIFGRYSAKLDVYSFGVILLETITGKKITGFFHEDPSLSLICHVWELWRAGRATEAIDPSISIKHSSPNEVL
RCIQIGLLCVEENAADRPDMLSVVLMLNSETTPVPSPQKPAFVASVKPKLPLTKEQTTYSLNEMSFSGILSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11340 S-locus lectin protein kinase ... Lus10025242 0 1

Lus10025242 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.