Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05300 35 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006091 [exp] 130 / 5e-41 ND 35 / 0.001
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G134100 [exp] 59 / 7e-13 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025243 pacid=23157391 polypeptide=Lus10025243 locus=Lus10025243.g ID=Lus10025243.BGIv1.0 annot-version=v1.0 ATGGCGGTGGCGATCCTGGTGATGCTAATGTGTCAAGGTACATCAGCTAGGTTACTCTGCGGTTCTTTTTCGGAGGTTGGGGCATCACTGTCGGCTGGAA TTGCTCTGCCGATGGAGCAGAACAGAGAAGGGGGAGTTATAACTACTGTTGGTGGGAAGGACAAGAACTACTACAAGTCACTGTTGCTTAATGTTCTACC TAAGGGTAGTCGGGCACCATCAGGGCCAAGCAAGAGGAGCAACAACCTCGTCAACTAA
AA sequence Show only first row Show all	>Lus10025243 pacid=23157391 polypeptide=Lus10025243 locus=Lus10025243.g ID=Lus10025243.BGIv1.0 annot-version=v1.0 MAVAILVMLMCQGTSARLLCGSFSEVGASLSAGIALPMEQNREGGVITTVGGKDKNYYKSLLLNVLPKGSRAPSGPSKRSNNLVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025243 [exp]	0	1
AT2G35930		PUB23	plant U-box 23 (.1)		Lus10013584 [exp]	1.4	0.9563
AT3G05170			Phosphoglycerate mutase family...		Lus10015164 [exp]	2.4	0.9463
					Lus10006091 [exp]	3.5	0.9494
AT4G16600			Nucleotide-diphospho-sugar tra...		Lus10004717 [exp]	3.5	0.9440
AT1G30135	ZIM	TIFY5A, JAZ8	jasmonate-zim-domain protein 8...		Lus10023303 [exp]	5.7	0.9290
					Lus10039474 [exp]	6.0	0.9358
AT2G27310			F-box family protein (.1)		Lus10013309 [exp]	7.4	0.9170
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10020331 [exp]	7.9	0.9288
AT2G42760			unknown protein		Lus10029248 [exp]	8.9	0.9203
AT3G50310		MKKK20, MAPKKK2...	MAPKK kinase 20, mitogen-activ...		Lus10012668 [exp]	9.2	0.9370

Compare expression of checked genes

Lus10025243 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.