Lus10025259 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51710 120 / 1e-32 D-mannose binding lectin protein with Apple-like carbohydrate-binding domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009088 196 / 7e-61 AT3G51710 360 / 1e-119 D-mannose binding lectin protein with Apple-like carbohydrate-binding domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G132500 148 / 6e-43 AT3G51710 464 / 2e-161 D-mannose binding lectin protein with Apple-like carbohydrate-binding domain (.1)
PFAM info
Representative CDS sequence
>Lus10025259 pacid=23157326 polypeptide=Lus10025259 locus=Lus10025259.g ID=Lus10025259.BGIv1.0 annot-version=v1.0
ATGAAACAGTTGTGTGCAATCTTCTCCTCGATTCTGGCCCTCTTTCCCCTTGTTCTTCACAATGTCTACTCCAGAGCAGACATTCACATCGGGTACAGGC
TTTCACTTCCTGTCCCTGCCGACTACAGCCCTGGATTCATCGGCAGAGCTCTCTTCATGGAGACTCAACAGCCCGAACCCAACTTCAAAGTCGCCATAAG
CGTCGAGTCCTTGGTTCAAGGTCGATTCTCTTGTTCCCTCGAGGTGTTCCTAGGAGATGTCAAGGTCTGGAACTCTGGACATTACTCCCCGTTCTTCACC
ACGGACCAATGCGTGATTGAGCTCGCTCAAGACGGTGAATTGCAGCTCAAGGATGAAAATGGCCGACGACTCGGGTGGCGCTCTGGCACTTCTGCACAAG
AAGCTAGTGATTATGGAGACGGGGAATCTGGTTCTAGTGGACGCAATCGGCAGAGTCAAATGGCAGAGCTTCAACTTCCCAACGGATGTAATCTTGTGGG
GGCATAG
AA sequence
>Lus10025259 pacid=23157326 polypeptide=Lus10025259 locus=Lus10025259.g ID=Lus10025259.BGIv1.0 annot-version=v1.0
MKQLCAIFSSILALFPLVLHNVYSRADIHIGYRLSLPVPADYSPGFIGRALFMETQQPEPNFKVAISVESLVQGRFSCSLEVFLGDVKVWNSGHYSPFFT
TDQCVIELAQDGELQLKDENGRRLGWRSGTSAQEASDYGDGESGSSGRNRQSQMAELQLPNGCNLVGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G51710 D-mannose binding lectin prote... Lus10025259 0 1
AT5G03810 GDSL-like Lipase/Acylhydrolase... Lus10035590 1.4 0.8898
Lus10022031 2.0 0.8903
AT5G01180 ATPTR5 ARABIDOPSIS THALIANA PEPTIDE T... Lus10018207 3.5 0.8654
Lus10013622 4.0 0.8229
AT2G45720 ARM repeat superfamily protein... Lus10016848 8.0 0.8459
AT1G64610 Transducin/WD40 repeat-like su... Lus10017312 8.7 0.8284
AT2G32260 ATCCT1 phosphorylcholine cytidylyltra... Lus10027337 16.9 0.8234
Lus10006638 24.1 0.7772
AT1G61660 bHLH bHLH112 basic helix-loop-helix (bHLH) ... Lus10007613 24.3 0.7945
AT1G01550 BPS1 BYPASS 1, Protein of unknown f... Lus10039581 24.4 0.8228

Lus10025259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.