Lus10025268 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015596 106 / 1e-29 ND 41 / 2e-04
Lus10032852 97 / 7e-25 AT3G09510 62 / 2e-10 Ribonuclease H-like superfamily protein (.1)
Lus10027902 80 / 4e-19 ND 38 / 0.003
Lus10034050 77 / 2e-18 ND /
Lus10013055 74 / 5e-16 AT1G09080 332 / 8e-107 binding protein 3, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2)
Lus10041342 73 / 1e-15 AT5G65005 44 / 6e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10030004 69 / 2e-15 ND /
Lus10022333 66 / 3e-13 AT5G14260 753 / 0.0 Rubisco methyltransferase family protein (.1.2.3)
Lus10000488 62 / 2e-12 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF00075 RNase_H RNase H
Representative CDS sequence
>Lus10025268 pacid=23157339 polypeptide=Lus10025268 locus=Lus10025268.g ID=Lus10025268.BGIv1.0 annot-version=v1.0
ATGAGAGACCTGGACACTTGGACCAGCGCCTTCAGCCCGTCGGGCCCACCCACTCCTTTCCGATCCACTCCAAACCATCATGCTGACTGCCCACCGCCAA
ATACTCCGCATAGGAGTATTCACTATGACGGATCGTATATTTGCGATTTCCAGAAGGCAGCTTATGGTGTCGTTGCCCGTGACATCCATGGTCATCCCTA
TGACGATAAGAACATAACTTTCTTTTGTTCATCGGTGATTAATGCGGAAGCAAGAGCGATTCTTGAAGCCACTCACTTTGCCATAGCAAGTTCAGAGCCC
ACAACCATTTATTCGGATTGCATCACCATCATCAATATCATCAACAGTCGAGCACTCGCGTGGCCTTGGGCTTGCTATGCTACCATTGGCTCGATCCTCC
ACCTTCATGACAATGCACCGTGGATTAAATTTGCCTTCACTCCATGA
AA sequence
>Lus10025268 pacid=23157339 polypeptide=Lus10025268 locus=Lus10025268.g ID=Lus10025268.BGIv1.0 annot-version=v1.0
MRDLDTWTSAFSPSGPPTPFRSTPNHHADCPPPNTPHRSIHYDGSYICDFQKAAYGVVARDIHGHPYDDKNITFFCSSVINAEARAILEATHFAIASSEP
TTIYSDCITIINIINSRALAWPWACYATIGSILHLHDNAPWIKFAFTP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025268 0 1
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10009630 4.9 1.0000
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 5.0 1.0000
Lus10011605 5.5 1.0000
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026232 7.0 1.0000
AT2G15220 Plant basic secretory protein ... Lus10001608 7.1 1.0000
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 8.7 1.0000
AT2G24960 unknown protein Lus10042715 9.8 0.9619
AT4G33860 Glycosyl hydrolase family 10 p... Lus10033787 10.1 0.9530
AT5G52390 PAR1 protein (.1) Lus10018204 12.1 0.9618
AT4G32690 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemo... Lus10007678 12.1 1.0000

Lus10025268 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.