Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37330 110 / 7e-32 ALS3 aluminum sensitive 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009069 [exp] 124 / 3e-37 AT2G37330 420 / 4e-150 aluminum sensitive 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G215700 [exp] 119 / 3e-35 AT2G37330 419 / 1e-149 aluminum sensitive 3 (.1) Potri.016G082100 [exp] 119 / 3e-35 AT2G37330 437 / 9e-157 aluminum sensitive 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03649 [flax] [poplar] UPF0014 Uncharacterised protein family (UPF0014)
Representative CDS sequence Show only first row Show all	>Lus10025278 pacid=23157443 polypeptide=Lus10025278 locus=Lus10025278.g ID=Lus10025278.BGIv1.0 annot-version=v1.0 ATGCCGGGAGCAATGACGGGGCTCATAGTGGGAGGAGCTTCATCTTTAGAGGCGATCCAGCTTCAGATCGTGGTCATGAATATGCTCATCGGAGCGTCGA CAGTCAGCAGCATCATGTCTACTTATATGTGTTGGCCTGCCTTCTTCACCAAAGCTTATCAGTTGGAAACCACTGTTTTTGCCTCCGATTGA
AA sequence Show only first row Show all	>Lus10025278 pacid=23157443 polypeptide=Lus10025278 locus=Lus10025278.g ID=Lus10025278.BGIv1.0 annot-version=v1.0 MPGAMTGLIVGGASSLEAIQLQIVVMNMLIGASTVSSIMSTYMCWPAFFTKAYQLETTVFASD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37330		ALS3	aluminum sensitive 3 (.1)		Lus10025278 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Lus10006445 [exp]	5.2	0.7603
AT2G26650		AKT1, ATAKT1	K+ transporter 1, K+ transport...		Lus10017766 [exp]	6.9	0.7490
AT4G17970		ATALMT12, ALMT1...	"aluminum-activated, malate tr...		Lus10030975 [exp]	18.2	0.7285
AT3G55120		A11, CFI, TT5	TRANSPARENT TESTA 5, CHALCONE ...		Lus10030309 [exp]	21.6	0.6976
AT5G25840			Protein of unknown function (D...		Lus10006044 [exp]	22.2	0.7090
AT5G24030		SLAH3	SLAC1 homologue 3 (.1)		Lus10039312 [exp]	25.5	0.6864
AT3G56180			Protein of unknown function (D...		Lus10040968 [exp]	28.2	0.6906
AT2G26650		AKT1, ATAKT1	K+ transporter 1, K+ transport...		Lus10017765 [exp]	35.5	0.6761
AT3G47570			Leucine-rich repeat protein ki...		Lus10030845 [exp]	37.2	0.6793
AT3G47570			Leucine-rich repeat protein ki...		Lus10030846 [exp]	41.3	0.6565

Compare expression of checked genes

Lus10025278 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.