Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09590 143 / 2e-43 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 139 / 4e-41 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 127 / 3e-37 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G02730 125 / 5e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 124 / 1e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 124 / 2e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 122 / 2e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 122 / 4e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G30320 119 / 2e-34 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 116 / 3e-33 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009068 [exp] 331 / 2e-117 AT3G09590 149 / 1e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10003990 [exp] 223 / 5e-73 AT1G01310 140 / 3e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 140 / 2e-42 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 140 / 4e-42 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 139 / 6e-42 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 138 / 1e-41 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 133 / 3e-39 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10011318 [exp] 129 / 1e-37 AT4G31470 164 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 127 / 3e-37 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G082000 [exp] 170 / 2e-53 AT3G09590 137 / 2e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G215600 [exp] 167 / 2e-52 AT3G09590 132 / 1e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 136 / 7e-41 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 136 / 8e-41 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G007000 [exp] 127 / 6e-37 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083300 [exp] 121 / 5e-35 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 120 / 2e-34 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 119 / 2e-34 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.018G096028 [exp] 114 / 2e-31 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 111 / 3e-31 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10025279 pacid=23157351 polypeptide=Lus10025279 locus=Lus10025279.g ID=Lus10025279.BGIv1.0 annot-version=v1.0 ATGTCGTCCGCCGATCAAATCACGTCAATTCCTCCAATCTTCCTCTTTCTCCTCCTCCTCATCGCCGCCGCCGTCCCCGACTGCTCCGGCCAAAAACTGT CGGTGGAGCGGCCGAACCGCGGGACATCGGTGGCCGGATTATCCTCGCAATTCCTGTCGGCCCACAACAAGGTACGGTCCAGGTACTACCTGCCGGCCCT GAAATGGAACCGGAACCTGGCCCGGTTCGCCAGGCACTACGCCTACACGCGCCAGCACGACTGTCAGCTGATCCACTCGGACAATCGGGTGTACGGGGAG AACTTGTTCTGGAGCAAGCACGGGCACTGGACGGCGGAGAACGTGGTGAAGAAGTGGGCGGAGGAGAACAAGTACTACGATTTCGGGAGCAACCGGTGCT TGAACAACCAGCCGTGCGGGCATTTCACGCAGGTGATTTGGAAGTCGACCACCCAGCTGGGATGCGGTAAGGTCGAGTGTTATGGCGGGAAAGGGTTCTT GTTTGTCTGCGCTTACAACCCGCCCGGAAATTACTATTTCGAAGGCCCATTGGGCGGCCGGTTTAAGAACTCCATTGTCTAA
AA sequence Show only first row Show all	>Lus10025279 pacid=23157351 polypeptide=Lus10025279 locus=Lus10025279.g ID=Lus10025279.BGIv1.0 annot-version=v1.0 MSSADQITSIPPIFLFLLLLIAAAVPDCSGQKLSVERPNRGTSVAGLSSQFLSAHNKVRSRYYLPALKWNRNLARFARHYAYTRQHDCQLIHSDNRVYGE NLFWSKHGHWTAENVVKKWAEENKYYDFGSNRCLNNQPCGHFTQVIWKSTTQLGCGKVECYGGKGFLFVCAYNPPGNYYFEGPLGGRFKNSIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09590			CAP (Cysteine-rich secretory p...		Lus10025279 [exp]	0	1
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10031480 [exp]	1.4	0.7104
AT5G03620			Subtilisin-like serine endopep...		Lus10035599 [exp]	6.0	0.6754
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Lus10023434 [exp]	10.4	0.5875
AT4G33985			Protein of unknown function (D...		Lus10002400 [exp]	13.6	0.6699
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	13.7	0.6258
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	15.3	0.6258
					Lus10033096 [exp]	16.8	0.6258
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	18.1	0.6258
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	20.6	0.6178
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	22.7	0.6088

Compare expression of checked genes

Lus10025279 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.