Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02610 188 / 3e-63 Ribosomal L29 family protein (.1.2) AT3G09500 185 / 8e-62 Ribosomal L29 family protein (.1) AT2G39390 183 / 5e-61 Ribosomal L29 family protein (.1) AT3G55170 179 / 9e-60 Ribosomal L29 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024437 [exp] 196 / 2e-66 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2) Lus10003306 [exp] 189 / 2e-63 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1) Lus10030314 [exp] 187 / 6e-63 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1) Lus10019179 [exp] 185 / 6e-62 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2) Lus10023449 [exp] 181 / 8e-60 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10019180 [exp] 145 / 2e-46 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G214200 [exp] 187 / 6e-63 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) Potri.006G214100 [exp] 186 / 2e-62 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1) Potri.010G212300 [exp] 186 / 2e-62 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.008G048800 [exp] 186 / 4e-62 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [flax] [poplar] Ribo_L29 PF00831 [flax] [poplar] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Lus10025292 pacid=23157362 polypeptide=Lus10025292 locus=Lus10025292.g ID=Lus10025292.BGIv1.0 annot-version=v1.0 ATGGCGAGGATTAAGGTTCACGAGTTGAGGAACAAGTCGAAGACAGATCTCTTGAACCAGTTGACGGAGCTCAAGTCGGAGCTTTCCCTCCTCCGCGTCG CCAAGGTCACCGGCGGTGCACCTAACAAGCTATCCAAGATCAAGGTGGTGAGACTGTCGATTGCTCAGGTGCTTACCGTGATTTCTCAGAAGCAGAAGGC AGCTCTCAGAGAAGCTTACAAAAACAAAAAGCTCTTGCCACTGGATCTGCGTCCCAAGAAGACTCGCGCCATCCGCAGACGCCTCACCAAGCACCAAGCA TCACTGAAGACCGAGCGAGAGAAGAAGCGGGAGATGTACTTCCCGTTGAGGAAATTCGCAATCAAAGTTTAG
AA sequence Show only first row Show all	>Lus10025292 pacid=23157362 polypeptide=Lus10025292 locus=Lus10025292.g ID=Lus10025292.BGIv1.0 annot-version=v1.0 MARIKVHELRNKSKTDLLNQLTELKSELSLLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKLLPLDLRPKKTRAIRRRLTKHQA SLKTEREKKREMYFPLRKFAIKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02610			Ribosomal L29 family protein ...		Lus10025292 [exp]	0	1
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10016432 [exp]	1.0	0.9195
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10041029 [exp]	3.2	0.9089
AT2G19730			Ribosomal L28e protein family ...		Lus10037609 [exp]	3.9	0.9010
AT3G12390			Nascent polypeptide-associated...		Lus10041610 [exp]	4.6	0.8671
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Lus10006914 [exp]	5.7	0.8863
AT2G47580		U1A	spliceosomal protein U1A (.1)		Lus10003358 [exp]	6.0	0.8714
AT3G52570			alpha/beta-Hydrolases superfam...		Lus10016992 [exp]	7.4	0.8785
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10005348 [exp]	9.5	0.8621
AT1G04190		TPR3	tetratricopeptide repeat 3, Te...		Lus10041189 [exp]	9.6	0.8222
AT1G03150			Acyl-CoA N-acyltransferases (N...		Lus10042595 [exp]	10.0	0.8245

Compare expression of checked genes

Lus10025292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.