Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55240 101 / 2e-29 Plant protein 1589 of unknown function (.1) AT5G02580 100 / 3e-29 Plant protein 1589 of unknown function (.1.2) AT3G28990 95 / 6e-27 Plant protein 1589 of unknown function (.1) AT1G10657 73 / 3e-18 Plant protein 1589 of unknown function (.1.2.3.4) AT3G61700 54 / 1e-09 Plant protein 1589 of unknown function (.1.2) AT2G46420 53 / 2e-09 Plant protein 1589 of unknown function (.1.2) AT5G04090 52 / 4e-09 Plant protein 1589 of unknown function (.1.2) AT3G10250 51 / 8e-09 Plant protein 1589 of unknown function (.1.2) AT3G45800 46 / 8e-07 Plant protein 1589 of unknown function (.1) AT1G49700 45 / 9e-07 Plant protein 1589 of unknown function (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024432 [exp] 142 / 2e-45 AT5G02580 112 / 1e-33 Plant protein 1589 of unknown function (.1.2) Lus10030322 [exp] 61 / 7e-14 AT3G55240 83 / 1e-22 Plant protein 1589 of unknown function (.1) Lus10003293 [exp] 61 / 8e-14 AT3G55240 85 / 2e-23 Plant protein 1589 of unknown function (.1) Lus10004016 [exp] 55 / 5e-10 AT3G61700 253 / 3e-83 Plant protein 1589 of unknown function (.1.2) Lus10031001 [exp] 55 / 6e-10 AT3G10250 392 / 3e-137 Plant protein 1589 of unknown function (.1.2) Lus10035397 [exp] 55 / 7e-10 AT3G23270 526 / 2e-171 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10030264 [exp] 52 / 4e-09 AT2G46420 346 / 4e-117 Plant protein 1589 of unknown function (.1.2) Lus10019011 [exp] 50 / 3e-08 AT3G61700 212 / 4e-66 Plant protein 1589 of unknown function (.1.2) Lus10039340 [exp] 48 / 1e-07 AT3G61700 182 / 6e-55 Plant protein 1589 of unknown function (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G213500 [exp] 109 / 9e-33 AT5G02580 96 / 2e-27 Plant protein 1589 of unknown function (.1.2) Potri.010G211500 [exp] 107 / 1e-31 AT3G55240 113 / 3e-34 Plant protein 1589 of unknown function (.1) Potri.008G189100 [exp] 86 / 2e-23 AT1G10657 122 / 8e-38 Plant protein 1589 of unknown function (.1.2.3.4) Potri.010G042300 [exp] 82 / 1e-21 AT1G10657 119 / 1e-36 Plant protein 1589 of unknown function (.1.2.3.4) Potri.015G019500 [exp] 55 / 3e-10 AT3G61700 161 / 1e-46 Plant protein 1589 of unknown function (.1.2) Potri.014G097800 [exp] 54 / 1e-09 AT2G46420 503 / 5e-180 Plant protein 1589 of unknown function (.1.2) Potri.012G001700 [exp] 52 / 3e-09 AT2G46420 165 / 3e-48 Plant protein 1589 of unknown function (.1.2) Potri.006G041200 [exp] 52 / 5e-09 AT3G10250 396 / 4e-139 Plant protein 1589 of unknown function (.1.2) Potri.016G038100 [exp] 52 / 5e-09 AT3G10250 381 / 5e-133 Plant protein 1589 of unknown function (.1.2) Potri.002G169900 [exp] 51 / 9e-09 AT2G46420 500 / 1e-178 Plant protein 1589 of unknown function (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09713 [flax] [poplar] A_thal_3526 Plant protein 1589 of unknown function (A_thal_3526)
Representative CDS sequence Show only first row Show all	>Lus10025300 pacid=23157392 polypeptide=Lus10025300 locus=Lus10025300.g ID=Lus10025300.BGIv1.0 annot-version=v1.0 ATGGACGACTCTCCTGCTTCGTACATACACATGGTGCATCGACTTATAGAGGAGTGTCTGGTGTTCAACATGAGCAAAGAAGAGTGCATGGAAGCTCTGT CGAAGCACGCAAACATCAAACCAATCATCACTTCCACCGTCTGGAATGAGCTCCAGAAGGAGAACCCTGATTTCTTCCACGGCTACAACACCCGCCGCCG CAGATCACCAACGTCGTCTTCGCCGGCACCTTCTACTCCGCCTGCAACCACCGAACGGCGGATCAGAGCGCTAATCTCCGACCACCAAGATACGACGTCG GATTGA
AA sequence Show only first row Show all	>Lus10025300 pacid=23157392 polypeptide=Lus10025300 locus=Lus10025300.g ID=Lus10025300.BGIv1.0 annot-version=v1.0 MDDSPASYIHMVHRLIEECLVFNMSKEECMEALSKHANIKPIITSTVWNELQKENPDFFHGYNTRRRRSPTSSSPAPSTPPATTERRIRALISDHQDTTS D

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02580			Plant protein 1589 of unknown ...		Lus10025300 [exp]	0	1
AT4G36380		ROT3	ROTUNDIFOLIA 3, Cytochrome P45...		Lus10028345 [exp]	3.5	0.8731
AT1G78850			D-mannose binding lectin prote...		Lus10000579 [exp]	5.9	0.8702
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10015517 [exp]	7.1	0.8827
AT5G02580			Plant protein 1589 of unknown ...		Lus10024432 [exp]	11.0	0.8061
AT1G63855			Putative methyltransferase fam...		Lus10041869 [exp]	13.0	0.8667
AT3G17810		PYD1	pyrimidine 1 (.1)		Lus10041990 [exp]	13.4	0.8633
AT2G21120			Protein of unknown function (D...		Lus10012716 [exp]	14.4	0.8741
AT2G21120			Protein of unknown function (D...		Lus10010893 [exp]	15.5	0.8703
AT1G48960			Adenine nucleotide alpha hydro...		Lus10038945 [exp]	19.7	0.8599
AT4G32300		SD2-5	S-domain-2 5 (.1)		Lus10002917 [exp]	21.8	0.8690

Compare expression of checked genes

Lus10025300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.