Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53630 37 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024421 [exp] 65 / 1e-13 AT3G53630 200 / 3e-64 unknown protein Lus10003983 [exp] 52 / 3e-09 AT3G53630 207 / 1e-67 unknown protein Lus10023752 [exp] 50 / 3e-08 AT3G53630 207 / 1e-67 unknown protein Lus10022996 [exp] 41 / 8e-06 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G082400 [exp] 40 / 5e-05 AT3G53630 197 / 8e-64 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025312 pacid=23157322 polypeptide=Lus10025312 locus=Lus10025312.g ID=Lus10025312.BGIv1.0 annot-version=v1.0 ATGAGCTCATTCAACACCACTCCAAACTTCAATAACCTCCTCTTTCAAACTCTAATGGGCCGTCTCCATATCCGTCCTCCTCCCGTCCCCTCCCAAACTA AATCCCTCGAGGACCTCCTCCTCGACGCCGTCAACGATCTTTCCGACGACGACAACTCTGACTACGACTGCAACAAAACGCAGCTCCGCAAGGAGGAAGC TAGACTGGAGAAGGAGATCATTTGGGTGGTTCTGTCGGGGAATGTTGGAAATATGCACTTAGGGTTCGACCTTGGTGCGATGGCAGCATCATGGACTTGA
AA sequence Show only first row Show all	>Lus10025312 pacid=23157322 polypeptide=Lus10025312 locus=Lus10025312.g ID=Lus10025312.BGIv1.0 annot-version=v1.0 MSSFNTTPNFNNLLFQTLMGRLHIRPPPVPSQTKSLEDLLLDAVNDLSDDDNSDYDCNKTQLRKEEARLEKEIIWVVLSGNVGNMHLGFDLGAMAASWT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53630			unknown protein		Lus10025312 [exp]	0	1
AT3G16350	MYB		Homeodomain-like superfamily p...		Lus10037560 [exp]	3.7	0.9252
AT5G59340	HD	WOX2	WUSCHEL related homeobox 2 (.1...		Lus10016569 [exp]	4.8	0.9136
AT1G80460		GLI1, NHO1	nonhost resistance to P. s. ph...		Lus10025750 [exp]	7.1	0.9461
AT1G21400			Thiamin diphosphate-binding fo...		Lus10018945 [exp]	8.9	0.9284
AT1G18270			ketose-bisphosphate aldolase c...		Lus10008753 [exp]	10.1	0.9348
AT1G80460		GLI1, NHO1	nonhost resistance to P. s. ph...		Lus10035914 [exp]	11.2	0.9019
AT3G30390			Transmembrane amino acid trans...		Lus10036845 [exp]	11.9	0.9399
AT5G38900			Thioredoxin superfamily protei...		Lus10005082 [exp]	12.5	0.9126
AT4G26140		BGAL12	beta-galactosidase 12 (.1.2)		Lus10006009 [exp]	14.1	0.9279
					Lus10000300 [exp]	15.4	0.9167

Compare expression of checked genes

Lus10025312 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.