Lus10025313 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28720 185 / 3e-61 Histone superfamily protein (.1)
AT3G45980 183 / 2e-60 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT5G59910 181 / 1e-59 HTB4 Histone superfamily protein (.1)
AT2G37470 180 / 2e-59 Histone superfamily protein (.1)
AT3G53650 179 / 3e-59 Histone superfamily protein (.1)
AT1G07790 179 / 5e-59 HTB1 Histone superfamily protein (.1)
AT3G46030 179 / 6e-59 HTB11 Histone superfamily protein (.1)
AT5G02570 171 / 6e-56 Histone superfamily protein (.1)
AT3G09480 168 / 6e-55 Histone superfamily protein (.1)
AT5G22880 165 / 2e-53 HTB2, H2B HISTONE H2B, histone B2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017456 194 / 9e-65 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10037371 186 / 1e-61 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10023753 184 / 5e-61 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Lus10041347 183 / 1e-60 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 182 / 2e-60 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10016156 180 / 2e-59 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10017292 175 / 2e-57 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10028826 174 / 6e-56 AT2G28720 216 / 3e-72 Histone superfamily protein (.1)
Lus10005897 171 / 9e-56 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G230701 192 / 6e-64 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.017G123700 190 / 2e-63 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091200 183 / 2e-60 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 183 / 2e-60 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091400 181 / 8e-60 AT2G28720 186 / 1e-61 Histone superfamily protein (.1)
Potri.008G030500 175 / 1e-57 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.008G030400 175 / 2e-57 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.008G030600 175 / 2e-57 AT5G59910 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230801 173 / 1e-56 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.010G230600 173 / 1e-56 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10025313 pacid=23157428 polypeptide=Lus10025313 locus=Lus10025313.g ID=Lus10025313.BGIv1.0 annot-version=v1.0
ATGGCGCAGAAGGGGGAGAAAAAGCCTGCATTGGCGGACAAATCCCCAACCGCATCAGCCGAGAAGAAACCGAAGATCGAGAAGAGGGTGACCAATGAAG
GAGGCGCCGACAAGAAAAAGAAGAAGGTGAAGAAGAGCAGCGAGACGTACAAGATCTACATCTTCATGGTTTTGAAGCATGTGCATCCAGACATCGGGAT
CTCCAACAAAGCGATCGGGATCATGAACAGTTTCATCAACGACATTTTCGAGAAGCTCGCCCACGAGGCGTCGCGATTGGCCCGCTACAATAAGAAGCCT
ATGAACACGTTGAGGGAGATCCAGACCGCCGTCCGATTGGTTCTCCCTGGTGAACTCGCCAAGCACGCCGTTTCTGAGGGCACCAAGGCGGTTACCAAAT
TCACCAGCTCTTAA
AA sequence
>Lus10025313 pacid=23157428 polypeptide=Lus10025313 locus=Lus10025313.g ID=Lus10025313.BGIv1.0 annot-version=v1.0
MAQKGEKKPALADKSPTASAEKKPKIEKRVTNEGGADKKKKKVKKSSETYKIYIFMVLKHVHPDIGISNKAIGIMNSFINDIFEKLAHEASRLARYNKKP
MNTLREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28720 Histone superfamily protein (.... Lus10025313 0 1
AT1G10010 AAP8, ATAAP8 amino acid permease 8 (.1) Lus10037248 3.5 0.9461
AT1G22440 Zinc-binding alcohol dehydroge... Lus10009517 5.3 0.9486
Lus10006918 7.7 0.9466
AT5G60010 ferric reductase-like transmem... Lus10019390 9.5 0.9466
AT5G64030 S-adenosyl-L-methionine-depend... Lus10000839 9.9 0.8770
AT1G24420 HXXXD-type acyl-transferase fa... Lus10033658 10.8 0.8288
AT1G04670 unknown protein Lus10004041 11.0 0.9466
AT3G53690 RING/U-box superfamily protein... Lus10042610 12.2 0.9466
Lus10007508 13.4 0.9466
AT1G35710 Protein kinase family protein ... Lus10002293 14.5 0.7398

Lus10025313 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.