Lus10025317 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10025317 pacid=23157348 polypeptide=Lus10025317 locus=Lus10025317.g ID=Lus10025317.BGIv1.0 annot-version=v1.0
ATGATAAAAACGCATGTTCTTCTTCCCCAACCTTACGAGATAACCCTATCTTCAGTCTTCAACTTCTCCACCACCAACATCTCCCCTCCACGGGTCGTCT
CCTCCTATTTCCACCAGCATCCTTCTCCACTTGCCGCGAGAACAGCTTCTCCACCTCCTCCTGTCGGCACCACCGCAGCCACTGGTCGTCTCCACCACCT
TCCCCAGCATCTGAGCGTCCACCAGTCGCCGCCACCGCCTCTACCAGTGCCGACTCTCCTCCTGTTGCAACCACCGCCTCCACCAGCACCGACTCTCCTC
CTATCGCCAACACCGCCTCCACCAGCATTTGGTTTCTTATTCATTTTTGTTTTGTTACAGATTCGGCTGTCGTTGGCTTTCAAAATATTGATGTTCTCCT
CCAACATCAGTGAAAAGCAGCTCCTATTTCTCCTTGTAGGCTTCTACCACACGCTTAGCGGTTGA
AA sequence
>Lus10025317 pacid=23157348 polypeptide=Lus10025317 locus=Lus10025317.g ID=Lus10025317.BGIv1.0 annot-version=v1.0
MIKTHVLLPQPYEITLSSVFNFSTTNISPPRVVSSYFHQHPSPLAARTASPPPPVGTTAATGRLHHLPQHLSVHQSPPPPLPVPTLLLLQPPPPPAPTLL
LSPTPPPPAFGFLFIFVLLQIRLSLAFKILMFSSNISEKQLLFLLVGFYHTLSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025317 0 1
AT1G03495 HXXXD-type acyl-transferase fa... Lus10039720 4.0 0.8164
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10028513 7.4 0.7950
AT4G00050 bHLH bHLH016, UNE10 unfertilized embryo sac 10, ba... Lus10003471 10.3 0.8313
AT4G29250 HXXXD-type acyl-transferase fa... Lus10028335 11.4 0.8218
AT1G04760 ATVAMP726 vesicle-associated membrane pr... Lus10000754 16.0 0.8127
AT1G01630 Sec14p-like phosphatidylinosit... Lus10040252 16.5 0.8175
AT5G02890 HXXXD-type acyl-transferase fa... Lus10011003 20.8 0.8064
AT2G27660 Cysteine/Histidine-rich C1 dom... Lus10004165 24.6 0.8067
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10028514 26.6 0.7972
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023317 28.1 0.7530

Lus10025317 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.