Lus10025319 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46010 251 / 2e-87 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT5G59890 247 / 8e-86 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT5G59880 246 / 2e-85 ADF3 actin depolymerizing factor 3 (.1.2)
AT3G46000 243 / 3e-84 ADF2 actin depolymerizing factor 2 (.1)
AT4G00680 231 / 2e-79 ADF8 actin depolymerizing factor 8 (.1)
AT1G01750 229 / 5e-79 ADF11 actin depolymerizing factor 11 (.1)
AT4G25590 228 / 3e-78 ADF7 actin depolymerizing factor 7 (.1)
AT5G52360 221 / 1e-75 ADF10 actin depolymerizing factor 10 (.1)
AT2G31200 191 / 1e-63 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
AT4G34970 183 / 2e-60 ADF9 actin depolymerizing factor 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024417 285 / 1e-100 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10024418 280 / 8e-99 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2)
Lus10023428 250 / 7e-84 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2)
Lus10040307 246 / 5e-83 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2)
Lus10027474 218 / 1e-74 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
Lus10038859 212 / 4e-72 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1)
Lus10014977 211 / 7e-72 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Lus10039229 205 / 2e-69 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
Lus10022933 193 / 2e-64 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G236700 261 / 3e-91 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.009G028100 256 / 2e-89 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.010G208500 255 / 3e-89 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2)
Potri.009G028200 254 / 1e-88 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.001G236400 253 / 4e-88 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2)
Potri.008G052100 252 / 7e-88 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.015G144500 236 / 2e-81 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
Potri.012G141600 234 / 5e-81 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1)
Potri.001G106200 232 / 7e-80 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
Potri.003G125500 227 / 4e-78 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Lus10025319 pacid=23157423 polypeptide=Lus10025319 locus=Lus10025319.g ID=Lus10025319.BGIv1.0 annot-version=v1.0
ATGGCGAACGCAGCGTCTGGATTTGCAGTCGATGATGACTGCAAACTGAAATTCCTGGAGCTAAAGGCAAAAAGAACGTATCGCTTTGTTGTTTTCAAGA
TCGAGGAGAAGCAAAAGCAAGTCATTGTGGAGAAACTTGGTGAGCCAGGTGAAAGCTACGATGATTTCGCTGCTTGCCTCCCTGCCGATGAGTGCCGCTA
TGCTGTATTTGATTTTGACTTCGTCACCAAGGAGAACTGCCAGAAGAGCAGAATATTCTTCATCGCATGGTCTCCGGATACAGCAAGGGTGAGAAGCAAG
ATGATTTACGCCAGTTCAAAGGACAGATTCAAGAGAGAGCTTGACGGGATTCAGATCGAATTGCAAGCGACTGATCCAACCGAAATGGGACTTGACGTGT
TTAAAAGCCGTGCCAACTGA
AA sequence
>Lus10025319 pacid=23157423 polypeptide=Lus10025319 locus=Lus10025319.g ID=Lus10025319.BGIv1.0 annot-version=v1.0
MANAASGFAVDDDCKLKFLELKAKRTYRFVVFKIEEKQKQVIVEKLGEPGESYDDFAACLPADECRYAVFDFDFVTKENCQKSRIFFIAWSPDTARVRSK
MIYASSKDRFKRELDGIQIELQATDPTEMGLDVFKSRAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G46010 ATADF1, ADF1 actin depolymerizing factor 1 ... Lus10025319 0 1
AT1G75950 UIP1, SKP1A, AT... UFO INTERACTING PROTEIN 1, ARA... Lus10013575 2.0 0.8512
AT5G58060 ATYKT61, ATGP1,... SNARE-like superfamily protein... Lus10019047 2.6 0.8657
AT5G25450 Cytochrome bd ubiquinol oxidas... Lus10008081 4.9 0.8500
AT5G50460 secE/sec61-gamma protein trans... Lus10035206 4.9 0.8035
AT3G52560 MMZ4 ,UEV1D ,UE... MMS2 ZWEI HOMOLOGUE 4, ubiquit... Lus10029415 5.5 0.8335
AT2G40060 CLC2 clathrin light chain 2, Clathr... Lus10040187 5.8 0.7754
AT1G68360 C2H2ZnF C2H2 and C2HC zinc fingers sup... Lus10041427 6.3 0.7708
AT1G34780 ATAPRL4 APR-like 4 (.1.2) Lus10033449 6.5 0.7705
AT5G25450 Cytochrome bd ubiquinol oxidas... Lus10013113 7.7 0.8429
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10030871 9.5 0.8051

Lus10025319 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.