Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15000 101 / 2e-29 unknown protein AT4G34265 80 / 7e-21 unknown protein AT4G17310 48 / 3e-08 unknown protein AT5G11630 42 / 4e-06 unknown protein AT5G47455 42 / 4e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020971 [exp] 155 / 1e-50 AT2G15000 121 / 4e-37 unknown protein Lus10026596 [exp] 110 / 6e-33 AT2G15000 123 / 6e-38 unknown protein Lus10013885 [exp] 87 / 7e-23 AT2G15000 82 / 6e-21 unknown protein Lus10028954 [exp] 43 / 2e-06 AT4G17310 100 / 5e-29 unknown protein Lus10007477 [exp] 40 / 2e-05 AT4G17310 95 / 6e-27 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G093400 [exp] 107 / 6e-32 AT2G15000 73 / 4e-18 unknown protein Potri.001G298800 [exp] 106 / 3e-31 AT2G15000 78 / 4e-20 unknown protein Potri.017G068600 [exp] 49 / 1e-08 AT4G17310 94 / 2e-26 unknown protein Potri.001G333800 [exp] 42 / 6e-06 AT5G47455 54 / 1e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025365 pacid=23150855 polypeptide=Lus10025365 locus=Lus10025365.g ID=Lus10025365.BGIv1.0 annot-version=v1.0 ATGGCTTGGCGCAGTGGAGCCTCTTCCTTCTCACGCTCCTTGATGTCTGCCACCAGGGCACCGTCGATGCGTCCCTCTTCAATTCCTCTTCCCCGCCTCC GTCCGCCGACCACCTCCTCCCCTGGGGTCCAGTCCCGCCGAGTCTCCTTTTCTCCTTCCAGGAACTTGGGAGAGCTAGGATGCACTCAGTCTTTCTTGCC ACTATATAGTGTGGTCGCCAAGACCCAGCTCACTTCTCATCTCAATGCTAATTTGCGGGCTTTCAGCGAGCTGTCTCATGGTACCTTCTGCCGTTCTTGT CAAGATCGCTAG
AA sequence Show only first row Show all	>Lus10025365 pacid=23150855 polypeptide=Lus10025365 locus=Lus10025365.g ID=Lus10025365.BGIv1.0 annot-version=v1.0 MAWRSGASSFSRSLMSATRAPSMRPSSIPLPRLRPPTTSSPGVQSRRVSFSPSRNLGELGCTQSFLPLYSVVAKTQLTSHLNANLRAFSELSHGTFCRSC QDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15000			unknown protein		Lus10025365 [exp]	0	1
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10027839 [exp]	1.4	0.9138
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Lus10030894 [exp]	2.4	0.8830
AT2G17870		ATCSP3	ARABIDOPSIS COLD SHOCK DOMAIN ...		Lus10005066 [exp]	4.7	0.8873
AT3G27080		TOM20-3	translocase of outer membrane ...		Lus10006419 [exp]	5.1	0.8329
AT2G15000			unknown protein		Lus10020971 [exp]	8.7	0.8545
AT4G28730		GrxC5	glutaredoxin C5, Glutaredoxin ...		Lus10011915 [exp]	9.5	0.8489
AT4G22720			Actin-like ATPase superfamily ...		Lus10013054 [exp]	10.8	0.8134
AT3G15000			cobalt ion binding (.1)		Lus10032618 [exp]	11.8	0.8609
AT3G22330		ATRH53, PMH2	putative mitochondrial RNA hel...		Lus10035410 [exp]	12.6	0.8298
AT2G40290			Eukaryotic translation initiat...		Lus10007521 [exp]	13.7	0.8413

Compare expression of checked genes

Lus10025365 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.