Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004830 [exp] 196 / 6e-65 AT1G17930 48 / 4e-06 Aminotransferase-like, plant mobile domain family protein (.1) Lus10032986 [exp] 182 / 3e-61 ND / Lus10025363 [exp] 179 / 3e-59 ND 39 / 0.002 Lus10018964 [exp] 179 / 3e-59 ND / Lus10005957 [exp] 184 / 4e-59 AT1G48120 75 / 1e-14 hydrolases;protein serine/threonine phosphatases (.1) Lus10009744 [exp] 177 / 7e-59 ND / Lus10034870 [exp] 175 / 1e-58 ND / Lus10006899 [exp] 172 / 9e-57 ND / Lus10007688 [exp] 171 / 7e-56 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025367 pacid=23150822 polypeptide=Lus10025367 locus=Lus10025367.g ID=Lus10025367.BGIv1.0 annot-version=v1.0 ATGCCGTTTCAGTCTTTGTTTAGGCGTGCAGAGGATGTGACCGGCGCCGCCCCCCGATACATGTACTGGTATCGGCGCCACACCCACCCGCGCATCCTCA GACCCATCCATACTGGTGTAGCGGCCCCGAAAGATATGCTAGCTTACAGGGTGTTGGATCATATGCATCCATTCTATACTGGGCAGATGAGACAGGAGTA CGAGTCTGATGCTGAGTACCTAGAGGCGGTCGAGCATTTGAGATGCAGTGTTGCTGGCATGTACGTGGACTTCCGACACCAGAGACCGTACCGTTAG
AA sequence Show only first row Show all	>Lus10025367 pacid=23150822 polypeptide=Lus10025367 locus=Lus10025367.g ID=Lus10025367.BGIv1.0 annot-version=v1.0 MPFQSLFRRAEDVTGAAPRYMYWYRRHTHPRILRPIHTGVAAPKDMLAYRVLDHMHPFYTGQMRQEYESDAEYLEAVEHLRCSVAGMYVDFRHQRPYR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025367 [exp]	0	1
AT3G28470	MYB	TDF1, ATMYB35	DEFECTIVE IN MERISTEM DEVELOPM...		Lus10036660 [exp]	3.9	0.7248
AT2G38500			2-oxoglutarate (2OG) and Fe(II...		Lus10025240 [exp]	4.9	0.8406
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10001863 [exp]	6.9	0.7174
AT2G24100		ASG1	ALTERED SEED GERMINATION 1, un...		Lus10024256 [exp]	7.9	0.6529
AT5G22210			unknown protein		Lus10043407 [exp]	8.8	0.7586
AT2G14540		ATSRP2	serpin 2 (.1)		Lus10009905 [exp]	12.0	0.6883
AT3G13890	MYB	ATMYB26, MS35	MALE STERILE 35, myb domain pr...		Lus10015608 [exp]	13.4	0.6829
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Lus10014005 [exp]	18.8	0.6524
AT3G02960			Heavy metal transport/detoxifi...		Lus10015762 [exp]	19.9	0.6524
AT3G60730			Plant invertase/pectin methyle...		Lus10015877 [exp]	21.0	0.6524

Compare expression of checked genes

Lus10025367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.