Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18060 145 / 8e-44 SH3 domain-containing protein (.1) AT4G34660 127 / 8e-37 SH3 domain-containing protein (.1.2.3) AT1G31440 73 / 3e-16 SH3 domain-containing protein (.1) AT4G39020 64 / 7e-14 SH3 domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015253 [exp] 184 / 7e-59 AT4G18060 540 / 0.0 SH3 domain-containing protein (.1) Lus10011975 [exp] 175 / 3e-55 AT4G18060 548 / 0.0 SH3 domain-containing protein (.1) Lus10004584 [exp] 175 / 4e-55 AT4G18060 549 / 0.0 SH3 domain-containing protein (.1) Lus10028783 [exp] 121 / 3e-34 AT4G34660 596 / 0.0 SH3 domain-containing protein (.1.2.3) Lus10017501 [exp] 118 / 6e-33 AT4G34660 598 / 0.0 SH3 domain-containing protein (.1.2.3) Lus10017500 [exp] 108 / 2e-29 AT4G34660 569 / 0.0 SH3 domain-containing protein (.1.2.3) Lus10028785 [exp] 105 / 3e-29 AT4G34660 338 / 2e-117 SH3 domain-containing protein (.1.2.3) Lus10028784 [exp] 105 / 2e-28 AT4G34660 563 / 0.0 SH3 domain-containing protein (.1.2.3) Lus10034755 [exp] 74 / 2e-16 AT1G31440 397 / 1e-135 SH3 domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G354700 [exp] 160 / 1e-49 AT4G18060 538 / 0.0 SH3 domain-containing protein (.1) Potri.011G077500 [exp] 152 / 2e-46 AT4G18060 514 / 0.0 SH3 domain-containing protein (.1) Potri.009G123200 [exp] 113 / 5e-31 AT4G34660 566 / 0.0 SH3 domain-containing protein (.1.2.3) Potri.004G161300 [exp] 108 / 2e-29 AT4G34660 515 / 0.0 SH3 domain-containing protein (.1.2.3) Potri.001G128800 [exp] 104 / 6e-28 AT4G34660 362 / 6e-124 SH3 domain-containing protein (.1.2.3) Potri.003G105200 [exp] 100 / 2e-26 AT4G34660 325 / 1e-109 SH3 domain-containing protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0010 [flax] [poplar] SH3 PF00018 [flax] [poplar] SH3_1 SH3 domain
Representative CDS sequence Show only first row Show all	>Lus10025372 pacid=23150809 polypeptide=Lus10025372 locus=Lus10025372.g ID=Lus10025372.BGIv1.0 annot-version=v1.0 ATGAAATTGCAAGCAGCAGAGGCTAAGATGCAGGAGTTGAAGGCTAACATGGCAGTTCTAGGTAAAGAAGCTTCAGCTGCATTGGCTGCCATGGAAGCTC AGCAGCAACGACTGAAATTTCAAAGGCTTGTTTCGTTGGTTGAAGGTGAAAAGAATTATCACTTGCGAATCGGTGCTATACTCAGTGAATTCGAAACCGA AGCCACACATCCATTCTATGCAGAATCGGACAAGGAGTTGAGTTTGGCAATCGGGGACTTCATTGTCGTTCGAAAGGTTACGCCGGGAGGGTGGTCGGAA GGAGAATGCAAAGGGAAATCAGGATGGTTCCCGTCAGCATTCGTCTAG
AA sequence Show only first row Show all	>Lus10025372 pacid=23150809 polypeptide=Lus10025372 locus=Lus10025372.g ID=Lus10025372.BGIv1.0 annot-version=v1.0 MKLQAAEAKMQELKANMAVLGKEASAALAAMEAQQQRLKFQRLVSLVEGEKNYHLRIGAILSEFETEATHPFYAESDKELSLAIGDFIVVRKVTPGGWSE GECKGKSGWFPSAFV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18060			SH3 domain-containing protein ...		Lus10025372 [exp]	0	1
					Lus10038642 [exp]	9.8	0.8498
					Lus10043100 [exp]	13.6	0.8376
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10003481 [exp]	16.6	0.8351
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10026057 [exp]	20.0	0.8301
AT2G35190		NSPN11, ATNPSN1...	novel plant snare 11 (.1)		Lus10003004 [exp]	21.9	0.8252
					Lus10032968 [exp]	23.7	0.8246
					Lus10032696 [exp]	26.5	0.8238
AT5G49900			Beta-glucosidase, GBA2 type fa...		Lus10023340 [exp]	27.4	0.8204
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10021007 [exp]	28.7	0.7691
					Lus10024762 [exp]	29.1	0.8204

Compare expression of checked genes

Lus10025372 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.