Lus10025375 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46460 140 / 5e-39 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33990 125 / 1e-33 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G47580 119 / 1e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G22070 124 / 4e-33 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G12770 123 / 6e-33 MEF22 mitochondrial editing factor 22 (.1)
AT2G15690 122 / 6e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G26782 120 / 6e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G30700 120 / 1e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G02010 119 / 1e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G20230 119 / 2e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015256 182 / 4e-54 AT5G46460 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10032688 129 / 2e-35 AT2G15690 375 / 2e-124 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008570 126 / 2e-34 AT2G15690 375 / 9e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035157 118 / 2e-34 AT3G26782 221 / 2e-69 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020588 119 / 5e-33 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035164 123 / 7e-33 AT3G02010 962 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016387 120 / 2e-32 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031994 121 / 3e-32 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10019689 112 / 3e-32 AT2G22070 246 / 4e-78 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G354400 162 / 4e-47 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G058300 130 / 1e-35 AT2G15690 499 / 2e-170 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G091600 124 / 2e-33 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G322100 124 / 3e-33 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.007G085500 120 / 5e-32 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.002G237100 119 / 1e-31 AT3G02010 967 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G040100 119 / 1e-31 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G081700 118 / 3e-31 AT4G16835 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G038900 117 / 3e-31 AT2G15690 280 / 1e-88 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G184800 118 / 4e-31 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10025375 pacid=23150810 polypeptide=Lus10025375 locus=Lus10025375.g ID=Lus10025375.BGIv1.0 annot-version=v1.0
ATGGGTTTGACGCACTGGGCAAGGTCGATCACTTCCTCGTCCAAATCACTGATCTCCCATCACTTACCAACCCAGAGATTAGACCAAGCACGTGCAGTCT
TCGACACCATCCAATCCCCCGACGCGCATTTATCCACAATGATGATCACGGGTTACACTAGAAACGGCAGAATCGACGATGCCCTGAAGCTGTTCGACAA
AATGCCACACAGAGACGAAGCCGGATATGTTGCTGATCAGAGATACGCATTGCATGATGTGGAGGATGAACAGGAGGAAATGCTATCGTATCATAGCGAG
AGGATTGCGATCGGATTCATGCTGATTAGTACAGTGGAAGAGAGTAGGATTACGGTAATGAAGAATCTCAGAGCTTGTGGGGATTGCCATGCTGTTATAA
AGCTGATATACAAGATTGTGGGAAGGGAGATTGTTGTTAGAGATTCTGGGAGGTTTCACCATTTTAAGGATGGTGTTTGCTCATGCTCAGATTATTATTT
AAAAAGTTTAAGAAGGTAA
AA sequence
>Lus10025375 pacid=23150810 polypeptide=Lus10025375 locus=Lus10025375.g ID=Lus10025375.BGIv1.0 annot-version=v1.0
MGLTHWARSITSSSKSLISHHLPTQRLDQARAVFDTIQSPDAHLSTMMITGYTRNGRIDDALKLFDKMPHRDEAGYVADQRYALHDVEDEQEEMLSYHSE
RIAIGFMLISTVEESRITVMKNLRACGDCHAVIKLIYKIVGREIVVRDSGRFHHFKDGVCSCSDYYLKSLRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G02980 OTP85 ORGANELLE TRANSCRIPT PROCESSIN... Lus10025375 0 1
AT3G07610 IBM1 increase in bonsai methylation... Lus10004602 18.4 0.5834
AT1G31660 unknown protein Lus10027134 18.8 0.6407
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10022670 21.1 0.6406
Lus10013570 28.1 0.5764
AT2G44820 unknown protein Lus10026825 29.7 0.6242
AT1G19880 Regulator of chromosome conden... Lus10010614 30.4 0.5607
AT5G06540 Pentatricopeptide repeat (PPR)... Lus10031424 32.6 0.6248
Lus10021453 43.0 0.5950
AT2G17580 Polynucleotide adenylyltransfe... Lus10035995 48.7 0.5833
AT5G19730 Pectin lyase-like superfamily ... Lus10034981 50.6 0.5893

Lus10025375 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.