Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40690 81 / 5e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015261 [exp] 183 / 2e-61 AT5G40690 82 / 2e-20 unknown protein Lus10010488 [exp] 133 / 5e-41 AT5G40690 136 / 1e-40 unknown protein Lus10003797 [exp] 131 / 3e-40 AT5G40690 128 / 2e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G336200 [exp] 77 / 1e-18 AT5G40690 147 / 2e-44 unknown protein Potri.001G338100 [exp] 70 / 2e-16 AT5G40690 137 / 7e-42 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025381 pacid=23150891 polypeptide=Lus10025381 locus=Lus10025381.g ID=Lus10025381.BGIv1.0 annot-version=v1.0 ATGGCGAGGAGAGGATGGAAGCATGGTATGGTAAGCACGTTCACCACCGCCGGCCACGAATCCCCACCGCCCTCAGCAGCCAAGTTCACAGGGAAATGCG GGGTCCCGCGATGCAAGGAGTGCCACATCCACCCGTGTACGAAGTCCAAGGACAAGGCTAAAGGGACCCCGGAGTTCCGGTCCAACGATGTCACGTCCAA CCATATATCGGTTATGTGGCATGTTGTGGGTGGCGGCTGCCTGTTGAGATCTAATGGGTTTTCGGCCACCGGAGTATTGGATCGCTTAGTGAATGTAGAT AGATATTTCGATTTCGATGAAGCTCGTCGTTAG
AA sequence Show only first row Show all	>Lus10025381 pacid=23150891 polypeptide=Lus10025381 locus=Lus10025381.g ID=Lus10025381.BGIv1.0 annot-version=v1.0 MARRGWKHGMVSTFTTAGHESPPPSAAKFTGKCGVPRCKECHIHPCTKSKDKAKGTPEFRSNDVTSNHISVMWHVVGGGCLLRSNGFSATGVLDRLVNVD RYFDFDEARR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40690			unknown protein		Lus10025381 [exp]	0	1
AT5G53130		ATCNGC1, CNGC1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10003396 [exp]	10.5	0.8009
AT5G36930			Disease resistance protein (TI...		Lus10026845 [exp]	15.0	0.7879
					Lus10032841 [exp]	15.2	0.7900
AT1G45160			Protein kinase superfamily pro...		Lus10005470 [exp]	23.2	0.7768
AT3G15270	SBP	SPL5	squamosa promoter binding prot...		Lus10005548 [exp]	23.8	0.7760
AT1G33340			ENTH/ANTH/VHS superfamily prot...		Lus10008557 [exp]	27.0	0.7703
					Lus10039892 [exp]	28.1	0.7757
AT2G23200			Protein kinase superfamily pro...		Lus10012646 [exp]	31.9	0.7624
AT4G34390		XLG2	extra-large GTP-binding protei...		Lus10009897 [exp]	32.1	0.7733
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10014219 [exp]	37.1	0.6878

Compare expression of checked genes

Lus10025381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.