Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63900 37 / 0.0006 Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025387 [exp] 146 / 2e-42 AT5G58610 428 / 5e-132 PHD finger transcription factor, putative (.1) Lus10015266 [exp] 127 / 1e-35 AT5G58610 558 / 7e-176 PHD finger transcription factor, putative (.1) Lus10012522 [exp] 88 / 7e-22 AT5G58610 285 / 4e-84 PHD finger transcription factor, putative (.1) Lus10003352 [exp] 75 / 9e-19 AT5G58610 77 / 7e-17 PHD finger transcription factor, putative (.1) Lus10000368 [exp] 49 / 4e-08 AT5G63900 84 / 3e-17 Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain (.1) Lus10042283 [exp] 37 / 0.0007 AT3G08590 993 / 0.0 2,3-biphosphoglycerate-independent phosphoglycerate mutase 2, Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G072600 [exp] 48 / 7e-08 AT5G58610 453 / 1e-139 PHD finger transcription factor, putative (.1) Potri.002G118600 [exp] 39 / 0.0001 AT5G58610 436 / 5e-137 PHD finger transcription factor, putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025385 pacid=23150834 polypeptide=Lus10025385 locus=Lus10025385.g ID=Lus10025385.BGIv1.0 annot-version=v1.0 ATGTTCTTCATCTGGTTTTTAATTGTTCCAGATTCGGAAAGATTGCAGTTTGTGGATACCGTTTTCTTGAACTTTCCAGGCACCATCATGTGTCACAAAC TGTTGACCACCACCAATGAATCACGTCCATTGAAGAAAGAAATCCCATCATTGCCTAACTCTGGAAATGGTGAAGAAATGGAGCTGGAGCTTGATGGGTC ACCCAGCCTGGAATCTGAAGTGGTTCAAGCTGAGAGAACAGAGCAATAG
AA sequence Show only first row Show all	>Lus10025385 pacid=23150834 polypeptide=Lus10025385 locus=Lus10025385.g ID=Lus10025385.BGIv1.0 annot-version=v1.0 MFFIWFLIVPDSERLQFVDTVFLNFPGTIMCHKLLTTTNESRPLKKEIPSLPNSGNGEEMELELDGSPSLESEVVQAERTEQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025385 [exp]	0	1
AT5G65165		SDH2-3	succinate dehydrogenase 2-3 (....		Lus10028289 [exp]	8.4	0.8149
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10040226 [exp]	12.2	0.8030
AT5G17820			Peroxidase superfamily protein...		Lus10020311 [exp]	13.5	0.7481
AT5G58610			PHD finger transcription facto...		Lus10025387 [exp]	14.1	0.7833
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10021233 [exp]	18.0	0.7991
AT5G22460			alpha/beta-Hydrolases superfam...		Lus10020604 [exp]	28.6	0.7947
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10023335 [exp]	29.0	0.7928
AT5G18150			Methyltransferase-related prot...		Lus10034423 [exp]	29.2	0.7984
AT5G10930		CIPK5, SnRK3.24	SNF1-RELATED PROTEIN KINASE 3....		Lus10024075 [exp]	34.3	0.7690
AT5G58610			PHD finger transcription facto...		Lus10025386 [exp]	37.2	0.7574

Compare expression of checked genes

Lus10025385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.