Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06475 43 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015269 [exp] 180 / 3e-60 AT1G06475 59 / 1e-12 unknown protein Lus10004931 [exp] 82 / 3e-21 AT1G06475 47 / 7e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G131200 [exp] 69 / 2e-16 AT5G46295 / unknown protein Potri.011G079900 [exp] 61 / 2e-13 AT5G46295 57 / 3e-12 unknown protein Potri.005G203800 [exp] 54 / 1e-10 AT1G06475 64 / 5e-15 unknown protein Potri.002G058400 [exp] 44 / 4e-07 AT1G06475 64 / 5e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025392 pacid=23150858 polypeptide=Lus10025392 locus=Lus10025392.g ID=Lus10025392.BGIv1.0 annot-version=v1.0 ATGAGGAGAAACGATGCAACCTCAGACGGAGAAGAAGAAATCAGACCGGCAGCAAGCATGAGTCCGCCGTGCCTCGCCGCCGCCGATCGCGAGAGTAGGA AGACCAAGAAGAAGAGATCAGGATCGTGGGTTTTAAAGAAGATGATAATGAAAGTGAACAAAGAATCTCTGAGATGGAGGTGGAAGTACTTGACATCTGC TTTCAAATGGAAGCGAGTGGAACATCTTCAGATTTCGCTGGTCGACGACGTCCTCTTCAAGGTCGTTTCGGCTCTGGAGGCCGTCGTTTTGGTCGCCACT GTTTCCTTCTTCTACCTCTGCTGCGGCTGCCACTTTTGA
AA sequence Show only first row Show all	>Lus10025392 pacid=23150858 polypeptide=Lus10025392 locus=Lus10025392.g ID=Lus10025392.BGIv1.0 annot-version=v1.0 MRRNDATSDGEEEIRPAASMSPPCLAAADRESRKTKKKRSGSWVLKKMIMKVNKESLRWRWKYLTSAFKWKRVEHLQISLVDDVLFKVVSALEAVVLVAT VSFFYLCCGCHF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06475			unknown protein		Lus10025392 [exp]	0	1
AT5G50890			alpha/beta-Hydrolases superfam...		Lus10001506 [exp]	2.4	0.8831
AT3G56180			Protein of unknown function (D...		Lus10040968 [exp]	3.2	0.8418
AT1G65730		YSL7	YELLOW STRIPE like 7 (.1)		Lus10017406 [exp]	4.6	0.8773
AT4G38810			Calcium-binding EF-hand family...		Lus10026291 [exp]	6.0	0.8620
AT5G05180			unknown protein		Lus10034251 [exp]	6.6	0.8797
AT1G24625	C2H2ZnF	ZFP7	zinc finger protein 7 (.1)		Lus10028997 [exp]	10.2	0.8199
AT3G18590		AtENODL5	early nodulin-like protein 5 (...		Lus10022522 [exp]	10.8	0.8138
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Lus10032622 [exp]	11.5	0.8674
AT5G23040		CDF1	CELL GROWTH DEFECT FACTOR 1, P...		Lus10000868 [exp]	12.8	0.8310
AT3G43660			Vacuolar iron transporter (VIT...		Lus10025685 [exp]	13.0	0.8642

Compare expression of checked genes

Lus10025392 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.