Lus10025393 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G53530 149 / 1e-46 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
AT1G23465 148 / 3e-46 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G29960 142 / 2e-43 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT3G08980 62 / 1e-12 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT2G30440 45 / 5e-06 Plsp2B, TPP plastidic type I signal peptidase 2B, thylakoid processing peptide (.1)
AT1G06870 44 / 1e-05 Plsp2A plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015272 181 / 3e-58 AT1G53530 111 / 4e-31 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10005571 150 / 5e-47 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10013703 150 / 1e-42 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Lus10033448 79 / 2e-19 AT1G53530 110 / 1e-32 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10002492 64 / 3e-13 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10015755 62 / 2e-12 AT1G53530 86 / 4e-22 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10004822 59 / 2e-11 AT3G08980 190 / 9e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10022921 45 / 7e-06 AT2G31140 282 / 1e-97 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10032753 44 / 3e-05 AT1G06870 379 / 3e-125 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G092900 175 / 2e-56 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.007G071400 170 / 9e-55 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.001G380400 159 / 1e-50 AT1G53530 227 / 3e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.016G115100 59 / 3e-11 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.014G036400 45 / 9e-06 AT1G06870 377 / 8e-130 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.006G157900 40 / 0.0002 AT3G24590 357 / 5e-124 plastidic type i signal peptidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0299 Peptidase_SF PF00717 Peptidase_S24 Peptidase S24-like
Representative CDS sequence
>Lus10025393 pacid=23150785 polypeptide=Lus10025393 locus=Lus10025393.g ID=Lus10025393.BGIv1.0 annot-version=v1.0
ATGATGCGGAGCTTCATCAGAGAGGTCTGTGACCAAACCCTAATGGTGGCAAAGGCATACGCCATCCTCCACGTCACGAATTCTCACCTCTGTACACTTG
CACTTGCTTACGGTCCGAGCATGGTTCCAACTATCAACCTCACCGGCGACCTAATCCTCGCCGAAAGGGTCTCCCCCCGGCTTGGCAAGGTGAAAGTTGG
CGACATTGTTATAGTCCGATCGCCAGTAGTTCCGAGGAGGATTTTGACCAAACGAGTCCTTGGCATGGAGGGGCATCGAGTTACATACTTGCTCGATCCG
AAAAACAGCGACGAAGTCCACACCGTTGTGGTTCCGAAGGGGCATGTTTGGATACAAGGAGATAACATCTACAATTCGAAAGATTCGAGGGACTTCGGCC
CTGTTCCTTATGCCCTTGTTGAAGCTAAGTTGTTTTGGAGGGTATATATTCCTATTCTCTCAACTTTCCTCTCTCTGTATATGTACAAGGTTTAA
AA sequence
>Lus10025393 pacid=23150785 polypeptide=Lus10025393 locus=Lus10025393.g ID=Lus10025393.BGIv1.0 annot-version=v1.0
MMRSFIREVCDQTLMVAKAYAILHVTNSHLCTLALAYGPSMVPTINLTGDLILAERVSPRLGKVKVGDIVIVRSPVVPRRILTKRVLGMEGHRVTYLLDP
KNSDEVHTVVVPKGHVWIQGDNIYNSKDSRDFGPVPYALVEAKLFWRVYIPILSTFLSLYMYKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53530 Peptidase S24/S26A/S26B/S26C f... Lus10025393 0 1
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10017553 4.9 0.9113
AT5G54890 RNA-binding CRS1 / YhbY (CRM) ... Lus10040080 6.0 0.8987
AT2G04560 AtLpxB lipid X B, transferases, trans... Lus10035357 6.3 0.8907
AT5G41480 EMB9, ATDFA, GL... GLOBULAR ARREST1, EMBRYO DEFEC... Lus10038824 8.0 0.8708
AT1G20693 HMGBETA1, NFD2,... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10030738 8.1 0.8971
AT4G31460 Ribosomal L28 family (.1) Lus10013249 9.7 0.8885
AT1G13770 RUS3 ROOT UV-B SENSITIVE 3, Protein... Lus10037076 14.0 0.8728
AT1G49350 pfkB-like carbohydrate kinase ... Lus10009862 14.9 0.8589
AT5G20040 ATIPT9 ARABIDOPSIS THALIANA ISOPENTEN... Lus10027928 16.7 0.8773
AT2G25710 HCS1 holocarboxylase synthase 1 (.1... Lus10025604 19.8 0.8504

Lus10025393 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.