Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015280 [exp] 54 / 4e-10 AT5G45850 170 / 2e-45 Protein of unknown function (DUF688) (.1) Lus10025403 [exp] 49 / 1e-08 AT4G18630 167 / 9e-45 Protein of unknown function (DUF688) (.1) Lus10032767 [exp] 0 / 1 ND 38 / 3e-04
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05097 [flax] [poplar] DUF688 Protein of unknown function (DUF688)
Representative CDS sequence Show only first row Show all	>Lus10025405 pacid=23150797 polypeptide=Lus10025405 locus=Lus10025405.g ID=Lus10025405.BGIv1.0 annot-version=v1.0 ATGATGAGTCGGTTCTTGCCTGCTGCAAAGGCAATGACTTTGGATCAGCAGCCTCAGTACTCTACAAAGAAGCAGCAGCAACAATCGAGACCGATTGCTG TTGTTAGCCTACGGGAGTCGCTTGCTGCTATTGTTTCTTACTGCCATCCCAAGGAACAGAATGAAGAGGAAGACTGTTAA
AA sequence Show only first row Show all	>Lus10025405 pacid=23150797 polypeptide=Lus10025405 locus=Lus10025405.g ID=Lus10025405.BGIv1.0 annot-version=v1.0 MMSRFLPAAKAMTLDQQPQYSTKKQQQQSRPIAVVSLRESLAAIVSYCHPKEQNEEEDC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025405 [exp]	0	1
					Lus10010602 [exp]	8.8	0.5625
AT5G46940			Plant invertase/pectin methyle...		Lus10031483 [exp]	9.5	0.5918
AT5G48140			Pectin lyase-like superfamily ...		Lus10039154 [exp]	25.3	0.5114
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10041381 [exp]	30.0	0.4943
AT5G01880			RING/U-box superfamily protein...		Lus10025145 [exp]	37.2	0.4828
AT1G18760			Zinc finger, C3HC4 type (RING ...		Lus10020558 [exp]	64.8	0.4765
AT5G02280			SNARE-like superfamily protein...		Lus10023793 [exp]	76.8	0.4558
					Lus10020204 [exp]	87.5	0.4521
AT4G21300			Tetratricopeptide repeat (TPR)...		Lus10013405 [exp]	104.5	0.4064
AT1G76750			Protein of unknown function (D...		Lus10025591 [exp]	117.7	0.4307

Compare expression of checked genes

Lus10025405 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.