Lus10025432 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60860 422 / 1e-152 AtRABA1f RAB GTPase homolog A1F (.1)
AT3G15060 406 / 2e-146 AtRABA1g RAB GTPase homolog A1G (.1)
AT1G28550 391 / 1e-140 AtRABA1i RAB GTPase homolog A1I (.1)
AT2G33870 387 / 1e-138 ArRABA1h RAB GTPase homolog A1H (.1)
AT4G18430 383 / 2e-137 AtRABA1e RAB GTPase homolog A1E (.1)
AT4G18800 357 / 5e-127 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT5G45750 350 / 2e-124 AtRABA1c RAB GTPase homolog A1C (.1)
AT1G16920 338 / 1e-119 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT1G06400 333 / 1e-117 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
AT1G09630 311 / 5e-109 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015297 434 / 2e-157 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10013961 419 / 2e-151 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Lus10017679 417 / 2e-150 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
Lus10002178 416 / 2e-150 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
Lus10039895 390 / 3e-140 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
Lus10029253 356 / 1e-126 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 353 / 2e-125 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10020746 323 / 2e-113 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Lus10029789 322 / 3e-113 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G123600 412 / 9e-149 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.019G092500 411 / 2e-148 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.011G061300 409 / 2e-147 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Potri.001G374000 402 / 5e-145 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.011G070300 354 / 7e-126 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 352 / 4e-125 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.003G004100 315 / 3e-110 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.008G061300 302 / 4e-105 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.006G000300 300 / 1e-104 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.010G197200 300 / 3e-104 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10025432 pacid=23150780 polypeptide=Lus10025432 locus=Lus10025432.g ID=Lus10025432.BGIv1.0 annot-version=v1.0
ATGGCGTACAGAGCGGACGACGATTACGACTACTTGTTCAAGGTGGTGTTGATCGGCGACTCCGGCGTCGGAAAGTCCAACCTCCTGTCGCGTTTCACGA
GGAACGAGTTCAGCCTTGAATCCAAATCGACGATCGGCGTCGAGTTCGCCACGAGGAGCATTCACGTCGACGACAAGGTCGTCAAGGCTCAGATTTGGGA
CACCGCCGGCCAGGAAAGGTACCGAGCAATAACGAGTGCATACTACCGAGGCGCAGTCGGAGCACTCCTGGTGTATGATGTGACCCGCCACGTCACGTTC
GAGAACGTCGAGAGGTGGCTAAAGGAGCTCCGAGACCACACCGACACCAACATAGTGATCATGCTCGTCGGGAATAAGGCCGACCTCCGCCACCTGCGGG
CGGTCTCGACCGAGGACTCCAAGTCGTTCGCCGAGAGGGAGAACACCTTCTTCATGGAAACGTCCGCTCTCGAGTCCATGAACGTCGAGAACGCGTTCAC
CGAGGTGCTCACCCAGATCTACCGTGTCGTCGGCAGCAAGGCTCTCGACATCGGGGACGATCCCGCGGCCTTGCCGAGGGGGCAGACGATCAACGTCGGC
GGTAAAGATGACGTGTCTGCTGTCAAGAAAGCTGGCTGCTGCTCTTCTTAA
AA sequence
>Lus10025432 pacid=23150780 polypeptide=Lus10025432 locus=Lus10025432.g ID=Lus10025432.BGIv1.0 annot-version=v1.0
MAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTF
ENVERWLKELRDHTDTNIVIMLVGNKADLRHLRAVSTEDSKSFAERENTFFMETSALESMNVENAFTEVLTQIYRVVGSKALDIGDDPAALPRGQTINVG
GKDDVSAVKKAGCCSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Lus10025432 0 1
AT2G31040 ATP synthase protein I -relate... Lus10029836 6.3 0.8302
Lus10014040 8.5 0.8022
AT5G23240 DNAJ heat shock N-terminal dom... Lus10040990 12.5 0.8074
AT1G08500 AtENODL18 early nodulin-like protein 18 ... Lus10036067 25.1 0.8034
AT3G02690 nodulin MtN21 /EamA-like trans... Lus10031371 26.8 0.8037
AT1G02910 LPA1 LOW PSII ACCUMULATION1, tetrat... Lus10036345 30.7 0.7614
AT5G60850 DOF OBP4, AtDof5. 4 OBF binding protein 4 (.1) Lus10017882 31.1 0.7845
AT3G46970 ATPHS2, PHS2 Arabidopsis thaliana alpha-glu... Lus10001200 35.6 0.7856
AT1G70820 phosphoglucomutase, putative /... Lus10015835 35.9 0.7979
AT4G13250 NYC1, NYC NON-YELLOW COLORING 1, NAD(P)-... Lus10023644 39.2 0.7699

Lus10025432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.