Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28540 110 / 2e-32 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042196 [exp] 124 / 3e-37 AT1G28540 71 / 1e-16 unknown protein Lus10024553 [exp] 91 / 2e-25 AT1G28540 48 / 6e-09 unknown protein Lus10015296 [exp] 63 / 3e-13 AT4G17500 73 / 7e-17 ethylene responsive element binding factor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G051300 [exp] 117 / 3e-35 AT1G28540 102 / 1e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025433 pacid=23150853 polypeptide=Lus10025433 locus=Lus10025433.g ID=Lus10025433.BGIv1.0 annot-version=v1.0 ATGGCTGAACCAGAAAAACCCAATTCTCCTTCCCCGACGGAGCTCAAGGGCGTCGGAAAAAACAACAAGAACACCAACACCAGCTACTCGGGTCAGAAGC TCCACTACCCAAACCCGCCGGAGGGGGTAAACCCGGACGCGGCGACTTTAAGGGATCAGTGGCGATTCGCCATAAAGCAGTACAGCAGGTGGTATTCTCA AGCTTGGGGGACGGCGATTCTCGCCGGAGCCTCGTTCTTCGCTCTCGGCTGGATCATCAAGGGCGAAAATCCTCTCCCTTCTTTCAAATCCGATCACGAC AAAAACAACAACACCGATCATCCTCCTTCGCCTTCGGTCAAGGACTCGGATGCTGATTCTCGCCGTTGA
AA sequence Show only first row Show all	>Lus10025433 pacid=23150853 polypeptide=Lus10025433 locus=Lus10025433.g ID=Lus10025433.BGIv1.0 annot-version=v1.0 MAEPEKPNSPSPTELKGVGKNNKNTNTSYSGQKLHYPNPPEGVNPDAATLRDQWRFAIKQYSRWYSQAWGTAILAGASFFALGWIIKGENPLPSFKSDHD KNNNTDHPPSPSVKDSDADSRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28540			unknown protein		Lus10025433 [exp]	0	1
AT4G14340		CKL11, CKI1	CASEIN KINASE I-LIKE 11, casei...		Lus10021175 [exp]	2.0	0.9143
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10027335 [exp]	6.0	0.8921
AT3G51390			DHHC-type zinc finger family p...		Lus10041837 [exp]	8.7	0.8972
AT2G38900			Serine protease inhibitor, pot...		Lus10035626 [exp]	9.4	0.8922
AT4G10170			SNARE-like superfamily protein...		Lus10002944 [exp]	11.0	0.9036
AT1G04555			unknown protein		Lus10014458 [exp]	12.3	0.9061
AT1G68000		ATPIS1	phosphatidylinositol synthase ...		Lus10014117 [exp]	14.0	0.9032
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042904 [exp]	16.4	0.8933
AT1G60940		SNRK2-10, SNRK2...	SNF1-RELATED KINASE 2B, SUCROS...		Lus10001367 [exp]	17.1	0.8823
AT1G04555			unknown protein		Lus10023715 [exp]	18.3	0.8869

Compare expression of checked genes

Lus10025433 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.