Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17930 50 / 3e-08 Aminotransferase-like, plant mobile domain family protein (.1) AT2G04865 46 / 6e-07 Aminotransferase-like, plant mobile domain family protein (.1) AT2G25010 45 / 2e-06 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000686 [exp] 123 / 6e-37 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020970 [exp] 119 / 3e-33 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1) Lus10027047 [exp] 120 / 4e-33 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1) Lus10043081 [exp] 103 / 1e-29 AT1G17930 64 / 2e-12 Aminotransferase-like, plant mobile domain family protein (.1) Lus10041136 [exp] 96 / 5e-27 ND 39 / 2e-04 Lus10001981 [exp] 89 / 6e-23 AT1G17930 61 / 2e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10006165 [exp] 83 / 2e-20 AT5G45260 66 / 5e-12 SENSITIVE TO LOW HUMIDITY 1, RESISTANT TO RALSTONIA SOLANACEARUM 1, ARABIDOPSIS THALIANA WRKY DOMAIN PROTEIN 52, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) Lus10039393 [exp] 82 / 7e-20 AT1G17930 73 / 3e-14 Aminotransferase-like, plant mobile domain family protein (.1) Lus10016922 [exp] 77 / 8e-20 AT1G17930 45 / 1e-06 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10025434 pacid=23150782 polypeptide=Lus10025434 locus=Lus10025434.g ID=Lus10025434.BGIv1.0 annot-version=v1.0 ATGAGTGATGTACCGGAGTACGCTTGGGGTGCTGGTGCGCTAGTTTGGTTGTATCGTGAGTTAGGGAAGGCTAGCCGGGCGGATGCAAAGGCGATGTCAG GCTGTGTTACGTTGCTGCAGCCTCGGATTTACGAGTACTTCCCCAGAGTGCACCCTCCCATGATGATTCGACAGGAGCGTAGGGCGGAAGATGCATTAGC TGGCCGGTGGGATAGTGTTGGGAACCTAGTCGGGATGGCGGAGTCCTACCGGAGAGGTTGGACTACTACCGACGTCTTCTCGATAACATCGACCCCCGTG ATGTGA
AA sequence Show only first row Show all	>Lus10025434 pacid=23150782 polypeptide=Lus10025434 locus=Lus10025434.g ID=Lus10025434.BGIv1.0 annot-version=v1.0 MSDVPEYAWGAGALVWLYRELGKASRADAKAMSGCVTLLQPRIYEYFPRVHPPMMIRQERRAEDALAGRWDSVGNLVGMAESYRRGWTTTDVFSITSTPV M

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G04865			Aminotransferase-like, plant m...		Lus10025434 [exp]	0	1
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	5.0	0.9546
AT1G18190		GC2	golgin candidate 2 (.1)		Lus10009060 [exp]	5.0	0.9044
AT1G11340			S-locus lectin protein kinase ...		Lus10036139 [exp]	7.6	0.9512
AT2G27410	B3		Domain of unknown function (DU...		Lus10027284 [exp]	10.5	0.9446
					Lus10015828 [exp]	12.0	0.9407
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10031748 [exp]	12.6	0.8087
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	13.2	0.9404
AT1G49490			Leucine-rich repeat (LRR) fami...		Lus10027935 [exp]	15.4	0.9333
AT2G03200			Eukaryotic aspartyl protease f...		Lus10022917 [exp]	17.2	0.9330
AT5G15430			Plant calmodulin-binding prote...		Lus10000141 [exp]	17.8	0.9336

Compare expression of checked genes

Lus10025434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.