Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46030 100 / 9e-29 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015293 [exp] 122 / 6e-35 AT5G46030 154 / 2e-46 unknown protein Lus10014995 [exp] 47 / 4e-08 AT5G46030 74 / 6e-18 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G097300 [exp] 114 / 1e-34 AT5G46030 146 / 3e-47 unknown protein Potri.001G373400 [exp] 112 / 4e-34 AT5G46030 122 / 1e-37 unknown protein Potri.014G056000 [exp] 63 / 1e-14 AT5G46030 92 / 1e-25 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF05129 [flax] [poplar] Elf1 Transcription elongation factor Elf1 like
Representative CDS sequence Show only first row Show all	>Lus10025438 pacid=23150851 polypeptide=Lus10025438 locus=Lus10025438.g ID=Lus10025438.BGIv1.0 annot-version=v1.0 ATGGGAAAGAGGAAGTCAAGGGCAAAGCCAGCGCCGAGGAAGAGGATGGACAAGCTGGATACTGTGTTCAGTTGTCCCTTTTGCAATCATGGAACGAGTG TTGAGTGTCGCATTGACATGAAGAACTTGATTGGTGAAGCTTCGTGTGGTATATGCCAAGAGAGTTTCAGCACTACCATCACAGCCTTAACCGAACCAAT CGACGTATGGCAGCAGAACTCGAAGTACCGTCATCTATGTAGTGCTCTGCTGCGTATGGAGAAGGAAACCAAGTGA
AA sequence Show only first row Show all	>Lus10025438 pacid=23150851 polypeptide=Lus10025438 locus=Lus10025438.g ID=Lus10025438.BGIv1.0 annot-version=v1.0 MGKRKSRAKPAPRKRMDKLDTVFSCPFCNHGTSVECRIDMKNLIGEASCGICQESFSTTITALTEPIDVWQQNSKYRHLCSALLRMEKETK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G46030			unknown protein		Lus10025438 [exp]	0	1
AT1G26660			Prefoldin chaperone subunit fa...		Lus10026631 [exp]	1.0	0.9215
AT1G25260			Ribosomal protein L10 family p...		Lus10001072 [exp]	2.4	0.8804
AT5G57910			unknown protein		Lus10036255 [exp]	2.4	0.8686
AT3G11591			unknown protein		Lus10016986 [exp]	2.8	0.8621
AT5G63060			Sec14p-like phosphatidylinosit...		Lus10039952 [exp]	3.0	0.8350
AT5G12320			ankyrin repeat family protein ...		Lus10036033 [exp]	4.0	0.8174
AT5G62575		SDH7B, SDH7	succinate dehydrogenase 7B, su...		Lus10034122 [exp]	5.3	0.8016
AT1G27695			glycine-rich protein (.1.2)		Lus10032855 [exp]	6.7	0.8496
AT1G60670			Protein of unknown function (D...		Lus10013072 [exp]	8.1	0.8466
AT2G23090			Uncharacterised protein family...		Lus10019287 [exp]	8.4	0.8183

Compare expression of checked genes

Lus10025438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.